Fermented Food Database
This is the result page of browse. This page gives the information about peptides returned against the selected category. Further details of the peptide can be seen by clicking on the FMDB_ID. Further the user can sort the peptides on the basis of various fields by clicking on the respective headers.
The total number entries retrieved from this search are 124| FMDB_ID | PubMed ID | Reference | Title | Peptide_Sequence | Sequence | Length of peptide | Food_Matrix | Protein | pH | Temperature | Incubation Time | Activity | Experiment | Model | Assay for Activity Measurement | Culture | Hydrolysis | Method of analysis | M_Z ratio | Mass | IC50 |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| FMDB30 | 17430184 | NA | NA | ARHPHPHLSFM | ARHPHPHLSFM | 11 | Skim Milk | k-Casein | NA | NA | NA | Antioxidant | In vitro | NA | NA | Lactobacillus delbrueckii subsp.bulgaricus IFO13953 | proteinase | NA | NA | NA | NA |
| FMDB103 | 24135669 | NA | NA | VLPVPQK | VLPVPQK | 7 | Skimmed Milk | β-Casein | 5.82 | 37C | 24h | Antioxidant | In vitro | NA | NA | Bifidobacterium. bifidum MF20/5 | proteases | LC-MS | NA | NA | NA |
| FMDB189 | NA | hatmi16 | Identification of bioactive peptides derived from Caseins,glycosylation-dependent cell adhesion molecule-1 (GlyCAM-1), and peptidoglycan recognition protein-1 (PGRP-1) in fermented camel Milk | KVLPVPQ | KVLPVPQ | 7 | Camel skimmed Milk | β-Casein | 4.6 | 42c | 7h | Anti-hypertensive;Antioxidant | In vitro | NA | ABTS radical scavenging Trolox equivalent antioxidant capacity (TEAC) method | S. thermophilus LMD-9 (ATCC BAA-491®) | Protease | HPLC/nESI-MS/MS | NA | NA | 19mg/ml |
| FMDB190 | NA | hatmi16 | Identification of bioactive peptides derived from Caseins,glycosylation-dependent cell adhesion molecule-1 (GlyCAM-1), and peptidoglycan recognition protein-1 (PGRP-1) in fermented camel Milk | VPYPQR | VPYPQR | 6 | Camel skimmed Milk | β-Casein | 4.6 | 42c | 7h | Antioxidant;Anti-hypertensive | In vitro | NA | ABTS radical scavenging Trolox equivalent antioxidant capacity (TEAC) method | S. thermophilus LMD-9 (ATCC BAA-491®) | Protease | HPLC/nESI-MS/MS | NA | NA | NA |
| FMDB194 | NA | hatmi16 | Identification of bioactive peptides derived from Caseins,glycosylation-dependent cell adhesion molecule-1 (GlyCAM-1), and peptidoglycan recognition protein-1 (PGRP-1) in fermented camel Milk | PVRGLHP | PVRGLHP | 7 | Camel skimmed Milk | β-Casein | 4.6 | 42c | 7h | Antioxidant | In vitro | NA | ABTS radical scavenging Trolox equivalent antioxidant capacity (TEAC) method | S. thermophilus LMD-9 (ATCC BAA-491®) | Protease | HPLC/nESI-MS/MS | NA | NA | 19mg/ml |
| FMDB205 | 22103626; 17430184 | NA | NA | VKEAMAPK | VKEAMAPK | 8 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Antioxidant | NA | NA | NA | S.thermophilus 4F44 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB322 | 22103626 | NA | NA | PYVRYL | PYVRYL | 6 | Bovine sodium Caseinate | αS2-Casein | NA | 42C | 4h | Ace-inhibitory;Antioxidant | NA | NA | NA | S.thermophilus PB385 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB379 | 24135669;11170591 | NA | NA | VLPVPQK | VLPVPQK | 7 | probiotic femented Milk | β-Casein | 6.67 | 37C | 24h | Ace-inhibitory;Antioxidant | In vitro | NA | spectrophotometeric assay using HHL as substrate | Bifidobacterium bifidum MF 20/5 | proteinase and peptidase | LCMS | NA | NA | NA |
| FMDB705 | 22156436 | NA | NA | MAPAAVAAAEAGSK | MAPAAVAAAEAGSK | 14 | Whole wheat flour | NA | 3.40 ± 0.03 | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS47 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 1243.623 | NA |
| FMDB706 | 22156436 | NA | NA | DNIPIVIR | DNIPIVIR | 8 | Whole wheat flour | NA | 3.40 ± 0.03 | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS48 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 938.5549 | NA |
| FMDB707 | 22156436 | NA | NA | AIAGAGVLSGYDQLQILFFGK | AIAGAGVLSGYDQLQILFFGK | 21 | Spelt | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS49 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 2167.1677 | NA |
| FMDB708 | 22156436 | NA | NA | GNQEKVLELVQR | GNQEKVLELVQR | 12 | Spelt | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS50 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 1411.7783 | NA |
| FMDB709 | 22156436 | NA | NA | PAGSAAGAAP | PAGSAAGAAP | 10 | Spelt | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS51 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 769.8311 | NA |
| FMDB710 | 22156436 | NA | NA | EALEAMFL | EALEAMFL | 8 | Spelt | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS52 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 924.1021 | NA |
| FMDB711 | 22156436 | NA | NA | AAGAAAAARSAGQCGR | AAGAAAAARSAGQCGR | 16 | Spelt | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS53 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 1387.6738 | NA |
| FMDB712 | 22156436 | NA | NA | ITFAAYRR | ITFAAYRR | 8 | Spelt | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS54 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 998.1621 | NA |
| FMDB713 | 22156436 | NA | NA | HPVPPKKK | HPVPPKKK | 8 | Spelt | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS55 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 912.2177 | NA |
| FMDB714 | 22156436 | NA | NA | VFVDEGLEVLGWRPVPFNVSVVGRNAK | VFVDEGLEVLGWRPVPFNVSVVGRNAK | 27 | Rye | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS56 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 2982.608 | NA |
| FMDB715 | 22156436 | NA | NA | RLSLPAGAPVTVAVSP | RLSLPAGAPVTVAVSP | 16 | Rye | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS57 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 1535.8101 | NA |
| FMDB716 | 22156436 | NA | NA | NANGELCPNNMCCSQWGYCGLGSEFCGNGCQSGACCPEK | NANGELCPNNMCCSQWGYCGLGSEFCGNGCQSGACCPEK | 39 | Rye | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS58 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 4033.4843 | NA |
| FMDB717 | 22156436 | NA | NA | LCPVHRAADL | LCPVHRAADL | 10 | Rye | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS59 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 1095.3231 | NA |
| FMDB718 | 22156436 | NA | NA | PAEMVAAALDR | PAEMVAAALDR | 11 | Rye | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS60 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 1484.7511 | NA |
| FMDB719 | 22156436 | NA | NA | KVALMSAGSMH | KVALMSAGSMH | 11 | Rye | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS61 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 1131.2679 | NA |
| FMDB720 | 22156436 | NA | NA | DLADIPQQQRLMAGLALVVATVIFLK | DLADIPQQQRLMAGLALVVATVIFLK | 26 | Rye | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS62 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 2822.6092 | NA |
| FMDB721 | 22156436 | NA | NA | KNGSIFNSPSATAATIIHGHNYSGLAYLDFVTSK | KNGSIFNSPSATAATIIHGHNYSGLAYLDFVTSK | 34 | Rye | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS63 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 3580.795 | NA |
| FMDB722 | 22156436 | NA | NA | GTIFFSQEGDGPTSVTGSVSGLKPGLHGFHVHALGDTTNGCMSTGPHFNPTGK | GTIFFSQEGDGPTSVTGSVSGLKPGLHGFHVHALGDTTNGCMSTGPHFNPTGK | 53 | Rye | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS64 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 5338.5201 | NA |
| FMDB723 | 22156436 | NA | NA | YEWEPTVPNFDVAKDVTDM | YEWEPTVPNFDVAKDVTDM | 19 | kamut | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS65 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 2255.0093 | NA |
| FMDB724 | 22156436 | NA | NA | GVSNAAVVAGGH | GVSNAAVVAGGH | 12 | kamut | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS66 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 1037.5254 | NA |
| FMDB725 | 22156436 | NA | NA | DAQEFKR | DAQEFKR | 7 | kamut | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS67 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 892.4403 | NA |
| FMDB726 | 22156436 | NA | NA | PPGPGPGPPPPPGAAGRGGGG | PPGPGPGPPPPPGAAGRGGGG | 21 | kamut | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS68 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 1704.8721 | NA |
| FMDB727 | 22156436 | NA | NA | HKEMQAIFDVYIMFIN | HKEMQAIFDVYIMFIN | 16 | kamut | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS69 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 2000.3734 | NA |
| FMDB728 | 22156436 | NA | NA | TGGGSTSSSSSSSSSLGGGASRGSVVEAAPPATQGAAAANAPAVPVVVVDTQEAGIR | TGGGSTSSSSSSSSSLGGGASRGSVVEAAPPATQGAAAANAPAVPVVVVDTQEAGIR | 57 | kamut | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS70 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 5124.5196 | NA |
| FMDB729 | 22156436 | NA | NA | DTAAGYVAPPDPAVSTGDYGLAGAEAPHPHESAVMSGAAAAAVAPGGEAYTR | DTAAGYVAPPDPAVSTGDYGLAGAEAPHPHESAVMSGAAAAAVAPGGEAYTR | 52 | kamut | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS71 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 4921.2889 | NA |
| FMDB739 | NA | NA | APFPEVFGKEKVNEL | APFPEVFGKEKVNEL | 15 | fermented Milk ( lassi) | αS1-Casein | 4.6 | 37C | 10h | Antioxidant | NA | NA | NA | L.acidophilus NCDC-15,Lactococcus lactis NCDC-167 and S. thermophilus | Cell envelope protease | nano HPLCTRAPMS | NA | 1702.98 | NA | |
| FMDB744 | NA | NA | EPVLGPVRGPFP | EPVLGPVRGPFP | 12 | fermented Milk ( lassi) | β-Casein | 4.6 | 37C | 10h | Immunomodulatory;Antioxidant;Anti-microbial | NA | NA | NA | L.acidophilus NCDC-15,Lactococcus lactis NCDC-167 and S. thermophilus | Cell envelope protease | nano HPLCTRAPMS | NA | 1263.69 | NA | |
| FMDB745 | NA | NA | EPVLGPVRGPFPI | EPVLGPVRGPFPI | 13 | fermented Milk ( lassi) | β-Casein | 4.6 | 37C | 10h | Immunomodulatory;Antioxidant;Anti-microbial | NA | NA | NA | L.acidophilus NCDC-15,Lactococcus lactis NCDC-167 and S. thermophilus | Cell envelope protease | nano HPLCTRAPMS | NA | 1376.94 | NA | |
| FMDB747 | NA | NA | GVSKVKEAMAPKH | GVSKVKEAMAPKH | 13 | fermented Milk ( lassi) | β-Casein | 4.6 | 37C | 10h | Antioxidant | NA | NA | NA | L.acidophilus NCDC-15,Lactococcus lactis NCDC-167 and S. thermophilus | Cell envelope protease | nano HPLCTRAPMS | NA | 1380.84 | NA | |
| FMDB749 | NA | NA | KVLPVPQK | KVLPVPQK | 8 | fermented Milk ( lassi) | β-Casein | 4.6 | 37C | 10h | Antioxidant;Anti-hypertensive | NA | NA | NA | L.acidophilus NCDC-15,Lactococcus lactis NCDC-167 and S. thermophilus | Cell envelope protease | nano HPLCTRAPMS | NA | 907.63 | NA | |
| FMDB762 | NA | NA | QEPVLGPVRGPFPIIV | QEPVLGPVRGPFPIIV | 16 | fermented Milk ( lassi) | β-Casein | 4.6 | 37C | 10h | Ace-inhibitory;Antioxidant;Anti-microbial | In vitro | NA | spectrophotometric assay using HHL as substrate | L.acidophilus NCDC-15,Lactococcus lactis NCDC-167 and S. thermophilus | Cell envelope protease | nano HPLCTRAPMS | NA | 1717.07 | NA | |
| FMDB763 | NA | NA | SKVLPVPQKAVPYPQ | SKVLPVPQKAVPYPQ | 15 | fermented Milk ( lassi) | β-Casein | 4.6 | 37C | 10h | Antioxidant;Anti-microbial | NA | NA | NA | L.acidophilus NCDC-15,Lactococcus lactis NCDC-167 and S. thermophilus | Cell envelope protease | nano HPLCTRAPMS | NA | 1651.04 | NA | |
| FMDB774 | NA | NA | YQEPVLGPVRGPFPIIV | YQEPVLGPVRGPFPIIV | 17 | fermented Milk ( lassi) | β-Casein | 4.6 | 37C | 10h | Ace-inhibitory;Antioxidant;Immunomodulatory;Anti-microbial | In vitro | NA | spectrophotometric assay using HHL as substrate | L.acidophilus NCDC-15,Lactococcus lactis NCDC-167 and S. thermophilus | Cell envelope protease | nano HPLCTRAPMS | NA | 1880.2 | NA | |
| FMDB969 | NA | ledesma05 | Identification of antioxidant and ACE-inhibitory peptides in fermented Milk | KVLPVPQ | KVLPVPQ | 7 | WSE of commercial fermented Milk spain | β-Casein | NA | NA | NA | Ace-inhibitory;Antioxidant | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | NA | NA | RP-HPLC– tandem mass spectrometry (MS/MS) | NA | 779.6 | 39 μM |
| FMDB972 | NA | ledesma05 | Identification of antioxidant and ACE-inhibitory peptides in fermented Milk | VAPFPGVFGK | VAPFPGVFGK | 10 | WSE of commercial fermented Milk spain | αS1-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | NA | NA | RP-HPLC– tandem mass spectrometry (MS/MS) | NA | 1089.5 | NA |
| FMDB974 | NA | ledesma05 | Identification of antioxidant and ACE-inhibitory peptides in fermented Milk | HLPLPL | HLPLPL | 6 | WSE of commercial fermented Milk spain | β-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | NA | NA | RP-HPLC– tandem mass spectrometry (MS/MS) | NA | 688.5 | NA |
| FMDB977 | NA | ledesma05 | Identification of antioxidant and ACE-inhibitory peptides in fermented Milk | GPVRGPFPII | GPVRGPFPII | 10 | WSE of commercial fermented Milk spain | β-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | NA | NA | RP-HPLC– tandem mass spectrometry (MS/MS) | NA | 1051.5 | NA |
| FMDB979 | NA | ledesma05 | Identification of antioxidant and ACE-inhibitory peptides in fermented Milk | NQE | NQE | 3 | WSE of commercial fermented Milk spain | k-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | NA | NA | RP-HPLC– tandem mass spectrometry (MS/MS) | NA | 389.2 | NA |
| FMDB981 | NA | ledesma05 | Identification of antioxidant and ACE-inhibitory peptides in fermented Milk | AKYIPIQYVLSRYPSY | AKYIPIQYVLSRYPSY | 16 | WSE of commercial fermented Milk spain | k-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | NA | NA | RP-HPLC– tandem mass spectrometry (MS/MS) | NA | 1959.4 | NA |
| FMDB983 | NA | ledesma05 | Identification of antioxidant and ACE-inhibitory peptides in fermented Milk | IPIQYVL | IPIQYVL | 7 | WSE of commercial fermented Milk spain | k-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | NA | NA | RP-HPLC– tandem mass spectrometry (MS/MS) | NA | 844.6 | NA |
| FMDB985 | NA | ledesma05 | Identification of antioxidant and ACE-inhibitory peptides in fermented Milk | PPK | PPK | 3 | WSE of commercial fermented Milk spain | k-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | NA | NA | RP-HPLC– tandem mass spectrometry (MS/MS) | NA | 340.2 | NA |
| FMDB986 | NA | rhee04 | Potential Antioxidant Peptides in Rice wine | IHH | IHH | 3 | Rice wine | NA | NA | 5-10c | 3months | Antioxidant | NA | NA | Free Radical Scavenging Activity By DPPH method | Nuruk as starter | NA | Edman degradation using protein sequencer with an HPLC system | NA | NA | NA |
| FMDB987 | NA | Potential Antioxidant Peptides in Rice wine | VVH/N | VVH/N | 5 | Rice wine | NA | NA | 5-10c | 3months | Antioxidant | NA | NA | Free Radical Scavenging Activity By DPPH method | Nuruk as starter | NA | Edman degradation using protein sequencer with an HPLC system | NA | NA | NA | |
| FMDB988 | NA | Potential Antioxidant Peptides in Rice wine | LVP | LVP | 3 | Rice wine | NA | NA | 5-10c | 3months | Antioxidant | NA | NA | Free Radical Scavenging Activity By DPPH method | Nuruk as starter | NA | Edman degradation using protein sequencer with an HPLC system | NA | NA | NA | |
| FMDB989 | NA | Potential Antioxidant Peptides in Rice wine | L/VKRP | L/VKRP | 6 | Rice wine | NA | NA | 5-10c | 3months | Antioxidant | NA | NA | Free Radical Scavenging Activity By DPPH method | Nuruk as starter | NA | Edman degradation using protein sequencer with an HPLC system | NA | NA | NA | |
| FMDB1023 | 22783093 | NA | NA | LAGNGRSVGVEYV | LAGNGRSVGVEYV | 13 | vitis hybrid red wine made from Vitis hybrid–Vitis coignetiae must | NA | NA | 25C | 10days | Ace-inhibitory;Antioxidant | In vitro | NA | Spectrophotometric assay using HHL as substrate;Antioxidant by DPPH | S. cerevisiae KCTC 7904 | NA | NA | NA | NA | NA |
| FMDB1024 | 22783093 | NA | NA | ATQVPLVSSTSEGYTASQPLYQP | ATQVPLVSSTSEGYTASQPLYQP | 23 | vitis hybrid red wine made from Vitis hybrid–Vitis coignetiae must | NA | NA | 25C | 10days | Ace-inhibitory;Antioxidant | In vitro | NA | Spectrophotometric assay using HHL as substrate;Antioxidant by DPPH | S. cerevisiae KCTC 7904 | NA | NA | NA | NA | NA |
| FMDB1025 | 22783093 | NA | NA | NPADLPDAG | NPADLPDAG | 9 | vitis hybrid red wine made from Vitis hybrid–Vitis coignetiae must | NA | NA | 25C | 10days | Ace-inhibitory;Antioxidant | In vitro | NA | Spectrophotometric assay using HHL as substrate;Antioxidant by DPPH | S. cerevisiae KCTC 7904 | NA | NA | NA | NA | NA |
| FMDB1026 | 22783093 | NA | NA | TRHNIGFAAVDALARAWNISLA | TRHNIGFAAVDALARAWNISLA | 22 | vitis hybrid red wine made from Vitis hybrid–Vitis coignetiae must | NA | NA | 25C | 10days | Ace-inhibitory;Antioxidant | In vitro | NA | Spectrophotometric assay using HHL as substrate;Antioxidant by DPPH | S. cerevisiae KCTC 7904 | NA | NA | NA | NA | NA |
| FMDB1027 | 22783093 | NA | NA | TTTAATS | TTTAATS | 7 | vitis hybrid red wine made from Vitis hybrid–Vitis coignetiae must | NA | NA | 25C | 10days | Ace-inhibitory;Antioxidant | In vitro | NA | Spectrophotometric assay using HHL as substrate;Antioxidant by DPPH | S. cerevisiae KCTC 7904 | NA | NA | NA | NA | NA |
| FMDB1028 | 22783093 | NA | NA | REGAAPGAA | REGAAPGAA | 9 | vitis hybrid red wine made from Vitis hybrid–Vitis coignetiae must | NA | NA | 25C | 10days | Ace-inhibitory;Antioxidant | In vitro | NA | Spectrophotometric assay using HHL as substrate;Antioxidant by DPPH | S. cerevisiae KCTC 7904 | NA | NA | NA | NA | NA |
| FMDB1196 | 25218972 | NA | NA | LAFNPTQLEGQCHV | LAFNPTQLEGQCHV | 14 | Sheep cheese Whey | ovine βlactoglobulin, f(149–162) | NA | 45c | 4h | Antioxidant | In vitro | NA | ABTS radical scavenging assay | Bacillus sp.P7 | protease | nano-ESI-MS | 778.8811 | NA | NA |
| FMDB1292 | NA | farvin10 | Antioxidant activity of Yogurt peptides: Part 2 – Characterisation of peptide fractions | QQQTED | QQQTED | 6 | fish oil enriched Yogurt | β-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Assay by DPPH radicalscavenging | NA | NA | LC-MS/MS | NA | 748 | NA |
| FMDB1293 | NA | farvin10 | NA | NSKKTVD | NSKKTVD | 7 | fish oil enriched Yogurt | αS2-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Assay by DPPH radicalscavenging | NA | NA | LC-MS/MS | NA | 791.4 | NA |
| FMDB1294 | NA | farvin10 | NA | YP | YP | 2 | fish oil enriched Yogurt | β-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Assay by DPPH radicalscavenging | NA | NA | LC-MS/MS | NA | 279 | NA |
| FMDB1295 | NA | farvin10 | NA | YAKPA | YAKPA | 5 | fish oil enriched Yogurt | k-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Assay by DPPH radicalscavenging | NA | NA | LC-MS/MS | NA | 549.2 | NA |
| FMDB1296 | NA | farvin10 | NA | TVQVT | TVQVT | 5 | fish oil enriched Yogurt | k-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Assay by DPPH radicalscavenging | NA | NA | LC-MS/MS | NA | 547.2 | NA |
| FMDB1297 | NA | farvin10 | NA | TVQVTST | TVQVTST | 7 | fish oil enriched Yogurt | k-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Assay by DPPH radicalscavenging | NA | NA | LC-MS/MS | NA | 735.4 | NA |
| FMDB1298 | NA | farvin10 | NA | VPYPQ | VPYPQ | 5 | fish oil enriched Yogurt | β-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Assay by DPPH radicalscavenging | NA | NA | LC-MS/MS | NA | 603.3 | NA |
| FMDB1299 | NA | farvin10 | NA | PIGSENS | PIGSENS | 7 | fish oil enriched Yogurt | αS1-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Assay by DPPH radicalscavenging | NA | NA | LC-MS/MS | NA | 703.4 | NA |
| FMDB1300 | NA | farvin10 | NA | KAVPYPQ | KAVPYPQ | 7 | fish oil enriched Yogurt | β-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Assay by DPPH radicalscavenging | NA | NA | LC-MS/MS | NA | 802.5 | NA |
| FMDB1301 | NA | farvin10 | NA | TVQVTSTAV | TVQVTSTAV | 9 | fish oil enriched Yogurt | k-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Assay by DPPH radicalscavenging | NA | NA | LC-MS/MS | NA | 905.5 | NA |
| FMDB1302 | NA | farvin10 | NA | IESPPEIN | IESPPEIN | 8 | fish oil enriched Yogurt | k-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Assay by DPPH radicalscavenging | NA | NA | LC-MS/MS | NA | 898.3 | NA |
| FMDB1303 | NA | farvin10 | NA | NVPGEIVE | NVPGEIVE | 8 | fish oil enriched Yogurt | β-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Assay by DPPH radicalscavenging | NA | NA | LC-MS/MS | NA | 856.4 | NA |
| FMDB1304 | NA | farvin10 | NA | VIESPPEIN | VIESPPEIN | 9 | fish oil enriched Yogurt | k-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Assay by DPPH radicalscavenging | NA | NA | LC-MS/MS | NA | 997.6 | NA |
| FMDB1305 | NA | farvin10 | NA | KVLPVPE | KVLPVPE | 7 | fish oil enriched Yogurt | β-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Assay by DPPH radicalscavenging | NA | NA | LC-MS/MS | NA | 780.6 | NA |
| FMDB1306 | NA | farvin10 | NA | GVRGPFPII | GVRGPFPII | 9 | fish oil enriched Yogurt | β-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Assay by DPPH radicalscavenging | NA | NA | LC-MS/MS | NA | 996.3 | NA |
| FMDB1307 | NA | farvin10 | NA | DKIHPF | DKIHPF | 6 | fish oil enriched Yogurt | β-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Assay by DPPH radicalscavenging | NA | NA | LC-MS/MS | NA | 756.3 | NA |
| FMDB1308 | NA | farvin10 | NA | IPIQY | IPIQY | 5 | fish oil enriched Yogurt | k-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Assay by DPPH radicalscavenging | NA | NA | LC-MS/MS | NA | 633.3 | NA |
| FMDB1309 | NA | farvin10 | NA | VFGKEKVNEL | VFGKEKVNEL | 10 | fish oil enriched Yogurt | αS1-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Assay by DPPH radicalscavenging | NA | NA | LC-MS/MS | NA | 1162.7 | NA |
| FMDB1310 | NA | farvin10 | NA | ELQDKIHPF | ELQDKIHPF | 9 | fish oil enriched Yogurt | β-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Assay by DPPH radicalscavenging | NA | NA | LC-MS/MS | NA | 1126.6 | NA |
| FMDB1311 | NA | farvin10 | NA | YPFPGPIPN | YPFPGPIPN | 9 | fish oil enriched Yogurt | β-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Assay by DPPH radicalscavenging | NA | NA | LC-MS/MS | NA | 1001.6 | NA |
| FMDB1312 | NA | farvin10 | NA | QQPVLGPVRGPFP | QQPVLGPVRGPFP | 13 | fish oil enriched Yogurt | β-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Assay by DPPH radicalscavenging | NA | NA | LC-MS/MS | NA | 1392.9 | NA |
| FMDB1313 | NA | farvin10 | NA | HKEMPFPKYPVQPF | HKEMPFPKYPVQPF | 14 | fish oil enriched Yogurt | β-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Assay by DPPH radicalscavenging | NA | NA | LC-MS/MS | NA | 1746.9 | NA |
| FMDB1314 | NA | farvin10 | NA | MAPKHKEMPFPKYPVQPF | MAPKHKEMPFPKYPVQPF | 18 | fish oil enriched Yogurt | β-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Assay by DPPH radicalscavenging | NA | NA | LC-MS/MS | NA | 2173.2 | NA |
| FMDB1315 | NA | farvin10 | NA | LVYPFPGPIPN | LVYPFPGPIPN | 11 | fish oil enriched Yogurt | β-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Assay by DPPH radicalscavenging | NA | NA | LC-MS/MS | NA | 1213.6 | NA |
| FMDB1316 | NA | farvin10 | NA | SLVYPFPGPIPN | SLVYPFPGPIPN | 12 | fish oil enriched Yogurt | β-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Assay by DPPH radicalscavenging | NA | NA | LC-MS/MS | NA | 1300.6 | NA |
| FMDB1317 | NA | farvin10 | NA | MPFPKYPVQPF | MPFPKYPVQPF | 11 | fish oil enriched Yogurt | β-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Assay by DPPH radicalscavenging | NA | NA | LC-MS/MS | NA | 1351.6 | NA |
| FMDB1318 | NA | farvin10 | NA | TQTPVVVPPFLQPE | TQTPVVVPPFLQPE | 14 | fish oil enriched Yogurt | β-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Assay by DPPH radicalscavenging | NA | NA | LC-MS/MS | NA | 1552.4 | NA |
| FMDB1319 | NA | farvin10 | NA | YQQPVLGPVRGPFPII | YQQPVLGPVRGPFPII | 16 | fish oil enriched Yogurt | β-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Assay by DPPH radicalscavenging | NA | NA | LC-MS/MS | NA | 1782.1 | NA |
| FMDB1320 | NA | farvin10 | NA | RDMPIQAFLL | RDMPIQAFLL | 10 | fish oil enriched Yogurt | β-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Assay by DPPH radicalscavenging | NA | NA | LC-MS/MS | NA | 1203.7 | NA |
| FMDB1321 | NA | farvin10 | NA | QQPVLGPVRGPFPIIV | QQPVLGPVRGPFPIIV | 16 | fish oil enriched Yogurt | β-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Assay by DPPH radicalscavenging | NA | NA | LC-MS/MS | NA | 1719 | NA |
| FMDB1322 | NA | farvin10 | NA | YQQPVLGPVRGPFPIIV | YQQPVLGPVRGPFPIIV | 17 | fish oil enriched Yogurt | β-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Assay by DPPH radicalscavenging | NA | NA | LC-MS/MS | NA | 1882.1 | NA |
| FMDB1323 | NA | farvin10 | NA | MAPKHEMPFPKYP | MAPKHEMPFPKYP | 13 | fish oil enriched Yogurt | β-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Assay by DPPH radicalscavenging | NA | NA | LC-MS/MS | NA | 1701.5 | NA |
| FMDB1324 | NA | farvin10 | NA | SLPQNIPPLTQTPVVVPFLQPEVM | SLPQNIPPLTQTPVVVPFLQPEVM | 24 | fish oil enriched Yogurt | β-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Assay by DPPH radicalscavenging | NA | NA | LC-MS/MS | NA | 2742.2 | NA |
| FMDB1325 | NA | farvin10 | NA | NIPPLTQTPVVVPFLQPEVM | NIPPLTQTPVVVPFLQPEVM | 20 | fish oil enriched Yogurt | β-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Assay by DPPH radicalscavenging | NA | NA | LC-MS/MS | NA | 2317.2 | NA |
| FMDB1574 | NA | meira12 | Bioactive peptides in water-soluble extracts of ovine cheeses from Southern Brazil and Uruguay | KEMPFPKYPVE | KEMPFPKYPVE | 11 | WSE of Roquefort type cheese | β-Casein | NA | 31-33 c coking temp. | 90days of ripening | Anti-hypertensive;Antioxidant | In vitro | NA | spectrophotometric assay using HHL as substrate and DPPH radical scavenging activity | NA | NA | nano-ESI tandem mass spectrometry (MS/MS) | 682.840 +2 | 1363.68 | NA |
| FMDB1575 | NA | meira12 | Bioactive peptides in water-soluble extracts of ovine cheeses from Southern Brazil and Uruguay | WMHQPPQPLPPTVMFPPQSVL | WMHQPPQPLPPTVMFPPQSVL | 21 | WSE of Roquefort type cheese | β-Casein | NA | 31-33 c coking temp. | 90days of ripening | Anti-hypertensive;Antioxidant | In vitro | NA | spectrophotometric assay using HHL as substrate and DPPH radical scavenging activity | NA | NA | nano-ESI tandem mass spectrometry (MS/MS) | 1214.088+2 | 2426.18 | NA |
| FMDB1576 | NA | meira12 | Bioactive peptides in water-soluble extracts of ovine cheeses from Southern Brazil and Uruguay | MHQPPQPLPPTVMFPPQSVL | MHQPPQPLPPTVMFPPQSVL | 20 | WSE of Roquefort type cheese | β-Casein | NA | 31-33 c coking temp. | 90days of ripening | Anti-hypertensive;Antioxidant | In vitro | NA | spectrophotometric assay using HHL as substrate and DPPH radical scavenging activity | NA | NA | nano-ESI tandem mass spectrometry (MS/MS) | 1121.057+2 | 2240.11 | NA |
| FMDB1577 | NA | meira12 | Bioactive peptides in water-soluble extracts of ovine cheeses from Southern Brazil and Uruguay | HQPPQPLPPTVMFPPQSVL | HQPPQPLPPTVMFPPQSVL | 19 | WSE of Roquefort type cheese | β-Casein | NA | 31-33 c coking temp. | 90days of ripening | Anti-hypertensive;Antioxidant;Anti-microbial | In vitro | NA | spectrophotometric assay using HHL as substrate and DPPH radical scavenging activity | NA | NA | nano-ESI tandem mass spectrometry (MS/MS) | 1055.544+2 | 2109.09 | NA |
| FMDB1578 | NA | meira12 | Bioactive peptides in water-soluble extracts of ovine cheeses from Southern Brazil and Uruguay | YQEPVLGPVRGPFPI | YQEPVLGPVRGPFPI | 15 | WSE of Roquefort type cheese | β-Casein | NA | 31-33 c coking temp. | 90days of ripening | Anti-hypertensive;Antioxidant;Anti-microbial | In vitro | NA | spectrophotometric assay using HHL as substrate and DPPH radical scavenging activity | NA | NA | nano-ESI tandem mass spectrometry (MS/MS) | 834.880 +2 | 1667.76 | NA |
| FMDB1579 | NA | meira12 | Bioactive peptides in water-soluble extracts of ovine cheeses from Southern Brazil and Uruguay | QEPVLGPVRGPFPILV | QEPVLGPVRGPFPILV | 16 | WSE of Roquefort type cheese | β-Casein | NA | 31-33 c coking temp. | 90days of ripening | Anti-hypertensive;Antioxidant | In vitro | NA | spectrophotometric assay using HHL as substrate and DPPH radical scavenging activity | NA | NA | nano-ESI tandem mass spectrometry (MS/MS) | 859.491 +2 | 1716.98 | NA |
| FMDB1580 | NA | meira12 | Bioactive peptides in water-soluble extracts of ovine cheeses from Southern Brazil and Uruguay | QEPVLGPVRGPFPI | QEPVLGPVRGPFPI | 14 | WSE of Roquefort type cheese | β-Casein | NA | 31-33 c coking temp. | 90days of ripening | Anti-hypertensive;Antioxidant | In vitro | NA | spectrophotometric assay using HHL as substrate and DPPH radical scavenging activity | NA | NA | nano-ESI tandem mass spectrometry (MS/MS) | 753.416 +2 | 1504.83 | NA |
| FMDB1581 | NA | meira12 | Bioactive peptides in water-soluble extracts of ovine cheeses from Southern Brazil and Uruguay | PVLGPVRGPFPI | PVLGPVRGPFPI | 12 | WSE of Roquefort type cheese | β-Casein | NA | 31-33 c coking temp. | 90days of ripening | Anti-hypertensive;Antioxidant | In vitro | NA | spectrophotometric assay using HHL as substrate and DPPH radical scavenging activity | NA | NA | nano-ESI tandem mass spectrometry (MS/MS) | 624.847+ 2 | 1247.69 | NA |
| FMDB1582 | NA | meira12 | Bioactive peptides in water-soluble extracts of ovine cheeses from Southern Brazil and Uruguay | LGPVRGPFPI | LGPVRGPFPI | 10 | WSE of Roquefort type cheese | β-Casein | NA | 31-33 c coking temp. | 90days of ripening | Anti-hypertensive;Antioxidant | In vitro | NA | spectrophotometric assay using HHL as substrate and DPPH radical scavenging activity | NA | NA | nano-ESI tandem mass spectrometry (MS/MS) | 526.808 +2 | 1051.61 | NA |
| FMDB1583 | NA | meira12 | Bioactive peptides in water-soluble extracts of ovine cheeses from Southern Brazil and Uruguay | TDAPSFSDIPNPIGSENSGK | TDAPSFSDIPNPIGSENSGK | 20 | WSE of Roquefort type cheese | αS1-Casein | NA | 31-33 c coking temp. | 90days of ripening | Anti-hypertensive;Antioxidant | In vitro | NA | spectrophotometric assay using HHL as substrate and DPPH radical scavenging activity | NA | NA | nano-ESI tandem mass spectrometry (MS/MS) | 1016.976+2 | 2031.95 | NA |
| FMDB1584 | NA | meira12 | Bioactive peptides in water-soluble extracts of ovine cheeses from Southern Brazil and Uruguay | DIPNPIGSENSGKTTMPLW | DIPNPIGSENSGKTTMPLW | 19 | WSE of Roquefort type cheese | αS1-Casein | NA | 31-33 c coking temp. | 90days of ripening | Anti-hypertensive;Antioxidant;Anti-microbial | In vitro | NA | spectrophotometric assay using HHL as substrate and DPPH radical scavenging activity | NA | NA | nano-ESI tandem mass spectrometry (MS/MS) | 1028.993+2 | 2055.98 | NA |
| FMDB1585 | NA | meira12 | Bioactive peptides in water-soluble extracts of ovine cheeses from Southern Brazil and Uruguay | IPNPIGSENSGKIT | IPNPIGSENSGKIT | 14 | WSE of Roquefort type cheese | αS1-Casein | NA | 31-33 c coking temp. | 90days of ripening | Anti-hypertensive;Antioxidant | In vitro | NA | spectrophotometric assay using HHL as substrate and DPPH radical scavenging activity | NA | NA | nano-ESI tandem mass spectrometry (MS/MS) | 713.872 +2 | 1425.74 | NA |
| FMDB1586 | NA | meira12 | Bioactive peptides in water-soluble extracts of ovine cheeses from Southern Brazil and Uruguay | NAGPFTPTVNR | NAGPFTPTVNR | 11 | WSE of Roquefort type cheese | αS2-Casein | NA | 31-33 c coking temp. | 90days of ripening | Anti-hypertensive;Antioxidant | In vitro | NA | spectrophotometric assay using HHL as substrate and DPPH radical scavenging activity | NA | NA | nano-ESI tandem mass spectrometry (MS/MS) | 587.320 +2 | 1172.62 | NA |
| FMDB1587 | NA | meira12 | Bioactive peptides in water-soluble extracts of ovine cheeses from Southern Brazil and Uruguay | YQGPIVLNPWDQVKR | YQGPIVLNPWDQVKR | 15 | WSE of Roquefort type cheese | αS2-Casein | NA | 31-33 c coking temp. | 90days of ripening | Anti-hypertensive;Antioxidant | In vitro | NA | spectrophotometric assay using HHL as substrate and DPPH radical scavenging activity | NA | NA | nano-ESI tandem mass spectrometry (MS/MS) | 604.993+ 3 | 1811.96 | NA |
| FMDB1588 | NA | meira12 | Bioactive peptides in water-soluble extracts of ovine cheeses from Southern Brazil and Uruguay | YQGPIVLNPWDQVK | YQGPIVLNPWDQVK | 14 | WSE of Roquefort type cheese | αS2-Casein | NA | 31-33 c coking temp. | 90days of ripening | Anti-hypertensive;Antioxidant | In vitro | NA | spectrophotometric assay using HHL as substrate and DPPH radical scavenging activity | NA | NA | nano-ESI tandem mass spectrometry (MS/MS) | 828.895 +2 | 1655.78 | NA |
| FMDB1589 | NA | meira12 | Bioactive peptides in water-soluble extracts of ovine cheeses from Southern Brazil and Uruguay | GPIVLNPWDQVKR | GPIVLNPWDQVKR | 13 | WSE of Roquefort type cheese | αS2-Casein | NA | 31-33 c coking temp. | 90days of ripening | Anti-hypertensive;Antioxidant | In vitro | NA | spectrophotometric assay using HHL as substrate and DPPH radical scavenging activity | NA | NA | nano-ESI tandem mass spectrometry (MS/MS) | 761.428+ 2 | 1520.86 | NA |
| FMDB1590 | NA | meira12 | Bioactive peptides in water-soluble extracts of ovine cheeses from Southern Brazil and Uruguay | VLNPWDQVKR | VLNPWDQVKR | 10 | WSE of Roquefort type cheese | αS2-Casein | NA | 31-33 c coking temp. | 90days of ripening | Anti-hypertensive;Antioxidant | In vitro | NA | spectrophotometric assay using HHL as substrate and DPPH radical scavenging activity | NA | NA | nano-ESI tandem mass spectrometry (MS/MS) | 627.840 +2 | 1253.68 | NA |
| FMDB1756 | 26616950;1169462 | NA | NA | YQEPVLGPVRGPFPIIV | YQEPVLGPVRGPFPIIV | 17 | Casein (raw Milk) | Casecidin-17 | NA | 23 C and then at 4c | 24 h +24h | Anti-microbial;Antithrombotic;Immunomodulatory;Antioxidant | NA | NA | NA | NA | Proteases | NA | NA | NA | NA |
| FMDB1757 | 26616950;1169462 | NA | NA | YQEPVLGPVRGPFPIIV | YQEPVLGPVRGPFPIIV | 17 | Casein (Heat treated Milk with open vials) | Casecidin-17 | NA | 23 C and then at 4c | 24 h +24h | Anti-microbial;Antithrombotic;Immunomodulatory;Antioxidant | NA | NA | NA | NA | Proteases | NA | NA | NA | NA |
| FMDB1758 | 26616950;1169462 | NA | NA | YQEPVLGPVRGPFPIIV | YQEPVLGPVRGPFPIIV | 17 | Casein (Heat treated Milk with closed vials) | Casecidin-17 | NA | 23 C and then at 4c | 24 h +24h | Anti-microbial;Antithrombotic;Immunomodulatory;Antioxidant | NA | NA | NA | NA | Proteases | NA | NA | NA | NA |
| FMDB1759 | 26616950;1169462 | NA | NA | YQEPVLGPVRGPFPIIV | YQEPVLGPVRGPFPIIV | 17 | Casein (Kefir) | Casecidin-17 | NA | 23 C and then at 4c | 24 h +24h | Anti-microbial;Antithrombotic;Immunomodulatory;Antioxidant | NA | NA | NA | Kefir grains(Lactobacillus,Lactococcus, Leuconostoc ,Streptococcus Saccharomyces, Candida, Kluyveromyces, Debaryomyces and Torulaspora) | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1782 | 26616950 | NA | NA | VYPFPGPIPN | VYPFPGPIPN | 10 | Casein (Kefir) | V-b-casomorphin-9 | NA | 23 C and then at 4c | 24 h +24h | Antioxidant | NA | NA | NA | Kefir grains(Lactobacillus,Lactococcus, Leuconostoc ,Streptococcus Saccharomyces, Candida, Kluyveromyces, Debaryomyces and Torulaspora) | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1966 | NA | amadou13 | Purification and characterization of foxtail millet-derived peptides with antioxidant and antimicrobial activities | SGYYMH | SGYYMH | 6 | defatted foxtail millet meal | NA | NA | 37c | 48h | Antioxidant | In vitro | NA | DPPH scavenging activityand the superoxide anion (O2 •−) scavenging activity | L. paracasei Fn032 | NA | HPLC MALDI–TOF–TOF MS | NA | 756.84 da | NA |
| FMDB1967 | NA | amadou13 | Purification and characterization of foxtail millet-derived peptides with antioxidant and antimicrobial activities | LGTFQN | LGTFQN | 6 | defatted foxtail millet meal | NA | NA | 37c | 48h | Antioxidant | In vitro | NA | DPPH scavenging activityand the superoxide anion (O2 •−) scavenging activity | L. paracasei Fn032 | NA | HPLC MALDI–TOF–TOF MS | NA | 678.74 Da | NA |
| FMDB1968 | NA | amadou13 | Purification and characterization of foxtail millet-derived peptides with antioxidant and antimicrobial activities | LHALLL | LHALLL | 6 | defatted foxtail millet meal | NA | NA | 37c | 48h | Antioxidant | In vitro | NA | DPPH scavenging activityand the superoxide anion (O2 •−) scavenging activity | L. paracasei Fn032 | NA | HPLC MALDI–TOF–TOF MS | NA | 678.87 Da | NA |
| FMDB2090 | 23871374;15030202 | NA | NA | VLSLSQSKVLPVPQK | VLSLSQSKVLPVPQK | 15 | Casein | β-Casein | 7 | 37c | 48h | Antioxidant | In vitro | NA | ABTS radical scavenging activity and total phenolic content measurement | Bifidobacterium longum KACC91563 | peptidase | LC-nano ESI-MS/MS | 541.6613+3 | 1621.9622 | NA |
| FMDB2092 | 23871374;15030202 | NA | NA | VLSLSQSKVLPVPQKAVPYPQRDMPIQA | VLSLSQSKVLPVPQKAVPYPQRDMPIQA | 28 | Casein | β-Casein | 7 | 37c | 48h | Antioxidant | In vitro | NA | ABTS radical scavenging activity and total phenolic content measurement | Bifidobacterium longum KACC91563 | peptidase | LC-nano ESI-MS/MS | 777.1820+4 | 3104.699 | NA |
| FMDB2119 | NA | NA | NA | VKEAMAPK | VKEAMAPK | 8 | Cheddar cheese | β-Casein | NA | NA | NA | Antioxidant | In vitro | NA | NA | Lactobacillus casei ssp. casei 300 | NA | LC-MS/MS | NA | 872.5048 | NA |
| FMDB2120 | NA | NA | NA | HIQKEDVPSER | HIQKEDVPSER | 11 | Cheddar cheese | αS1-Casein | NA | NA | NA | Antioxidant | In vitro | NA | NA | Lactobacillus casei ssp. casei 300 | NA | LC-MS/MS | NA | 1336.7034 | NA |
| FMDB2121 | NA | NA | NA | ARHPHPHLSFM | ARHPHPHLSFM | 11 | Skimmed Milk | k-Casein | NA | NA | NA | Antioxidant | In vitro | NA | NA | Lactobacillus delbrueckii subsp. bulgaricus IFO13953 | NA | mass spectrograph & amino acid sequencer | NA | NA | NA |