| FMDB30 | 17430184 | NA | NA | ARHPHPHLSFM | ARHPHPHLSFM | 11 | Skim Milk | k-Casein | NA | NA | NA | Antioxidant | In vitro | NA | NA | Lactobacillus delbrueckii subsp.bulgaricus IFO13953 | proteinase | NA | NA | NA | NA |
| FMDB103 | 24135669 | NA | NA | VLPVPQK | VLPVPQK | 7 | Skimmed Milk | β-Casein | 5.82 | 37C | 24h | Antioxidant | In vitro | NA | NA | Bifidobacterium. bifidum MF20/5 | proteases | LC-MS | NA | NA | NA |
| FMDB189 | NA | hatmi16 | Identification of bioactive peptides derived from Caseins,glycosylation-dependent cell adhesion molecule-1 (GlyCAM-1), and peptidoglycan recognition protein-1 (PGRP-1) in fermented camel Milk | KVLPVPQ | KVLPVPQ | 7 | Camel skimmed Milk | β-Casein | 4.6 | 42c | 7h | Anti-hypertensive;Antioxidant | In vitro | NA | ABTS radical scavenging Trolox equivalent antioxidant capacity (TEAC) method | S. thermophilus LMD-9 (ATCC BAA-491®) | Protease | HPLC/nESI-MS/MS | NA | NA | 19mg/ml |
| FMDB190 | NA | hatmi16 | Identification of bioactive peptides derived from Caseins,glycosylation-dependent cell adhesion molecule-1 (GlyCAM-1), and peptidoglycan recognition protein-1 (PGRP-1) in fermented camel Milk | VPYPQR | VPYPQR | 6 | Camel skimmed Milk | β-Casein | 4.6 | 42c | 7h | Antioxidant;Anti-hypertensive | In vitro | NA | ABTS radical scavenging Trolox equivalent antioxidant capacity (TEAC) method | S. thermophilus LMD-9 (ATCC BAA-491®) | Protease | HPLC/nESI-MS/MS | NA | NA | NA |
| FMDB194 | NA | hatmi16 | Identification of bioactive peptides derived from Caseins,glycosylation-dependent cell adhesion molecule-1 (GlyCAM-1), and peptidoglycan recognition protein-1 (PGRP-1) in fermented camel Milk | PVRGLHP | PVRGLHP | 7 | Camel skimmed Milk | β-Casein | 4.6 | 42c | 7h | Antioxidant | In vitro | NA | ABTS radical scavenging Trolox equivalent antioxidant capacity (TEAC) method | S. thermophilus LMD-9 (ATCC BAA-491®) | Protease | HPLC/nESI-MS/MS | NA | NA | 19mg/ml |
| FMDB205 | 22103626; 17430184 | NA | NA | VKEAMAPK | VKEAMAPK | 8 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Antioxidant | NA | NA | NA | S.thermophilus 4F44 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB322 | 22103626 | NA | NA | PYVRYL | PYVRYL | 6 | Bovine sodium Caseinate | αS2-Casein | NA | 42C | 4h | Ace-inhibitory;Antioxidant | NA | NA | NA | S.thermophilus PB385 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB379 | 24135669;11170591 | NA | NA | VLPVPQK | VLPVPQK | 7 | probiotic femented Milk | β-Casein | 6.67 | 37C | 24h | Ace-inhibitory;Antioxidant | In vitro | NA | spectrophotometeric assay using HHL as substrate | Bifidobacterium bifidum MF 20/5 | proteinase and peptidase | LCMS | NA | NA | NA |
| FMDB705 | 22156436 | NA | NA | MAPAAVAAAEAGSK | MAPAAVAAAEAGSK | 14 | Whole wheat flour | NA | 3.40 ± 0.03 | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS47 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 1243.623 | NA |
| FMDB706 | 22156436 | NA | NA | DNIPIVIR | DNIPIVIR | 8 | Whole wheat flour | NA | 3.40 ± 0.03 | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS48 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 938.5549 | NA |
| FMDB707 | 22156436 | NA | NA | AIAGAGVLSGYDQLQILFFGK | AIAGAGVLSGYDQLQILFFGK | 21 | Spelt | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS49 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 2167.1677 | NA |
| FMDB708 | 22156436 | NA | NA | GNQEKVLELVQR | GNQEKVLELVQR | 12 | Spelt | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS50 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 1411.7783 | NA |
| FMDB709 | 22156436 | NA | NA | PAGSAAGAAP | PAGSAAGAAP | 10 | Spelt | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS51 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 769.8311 | NA |
| FMDB710 | 22156436 | NA | NA | EALEAMFL | EALEAMFL | 8 | Spelt | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS52 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 924.1021 | NA |
| FMDB711 | 22156436 | NA | NA | AAGAAAAARSAGQCGR | AAGAAAAARSAGQCGR | 16 | Spelt | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS53 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 1387.6738 | NA |
| FMDB712 | 22156436 | NA | NA | ITFAAYRR | ITFAAYRR | 8 | Spelt | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS54 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 998.1621 | NA |
| FMDB713 | 22156436 | NA | NA | HPVPPKKK | HPVPPKKK | 8 | Spelt | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS55 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 912.2177 | NA |
| FMDB714 | 22156436 | NA | NA | VFVDEGLEVLGWRPVPFNVSVVGRNAK | VFVDEGLEVLGWRPVPFNVSVVGRNAK | 27 | Rye | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS56 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 2982.608 | NA |
| FMDB715 | 22156436 | NA | NA | RLSLPAGAPVTVAVSP | RLSLPAGAPVTVAVSP | 16 | Rye | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS57 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 1535.8101 | NA |
| FMDB716 | 22156436 | NA | NA | NANGELCPNNMCCSQWGYCGLGSEFCGNGCQSGACCPEK | NANGELCPNNMCCSQWGYCGLGSEFCGNGCQSGACCPEK | 39 | Rye | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS58 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 4033.4843 | NA |
| FMDB717 | 22156436 | NA | NA | LCPVHRAADL | LCPVHRAADL | 10 | Rye | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS59 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 1095.3231 | NA |
| FMDB718 | 22156436 | NA | NA | PAEMVAAALDR | PAEMVAAALDR | 11 | Rye | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS60 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 1484.7511 | NA |
| FMDB719 | 22156436 | NA | NA | KVALMSAGSMH | KVALMSAGSMH | 11 | Rye | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS61 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 1131.2679 | NA |
| FMDB720 | 22156436 | NA | NA | DLADIPQQQRLMAGLALVVATVIFLK | DLADIPQQQRLMAGLALVVATVIFLK | 26 | Rye | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS62 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 2822.6092 | NA |
| FMDB721 | 22156436 | NA | NA | KNGSIFNSPSATAATIIHGHNYSGLAYLDFVTSK | KNGSIFNSPSATAATIIHGHNYSGLAYLDFVTSK | 34 | Rye | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS63 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 3580.795 | NA |
| FMDB722 | 22156436 | NA | NA | GTIFFSQEGDGPTSVTGSVSGLKPGLHGFHVHALGDTTNGCMSTGPHFNPTGK | GTIFFSQEGDGPTSVTGSVSGLKPGLHGFHVHALGDTTNGCMSTGPHFNPTGK | 53 | Rye | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS64 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 5338.5201 | NA |
| FMDB723 | 22156436 | NA | NA | YEWEPTVPNFDVAKDVTDM | YEWEPTVPNFDVAKDVTDM | 19 | kamut | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS65 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 2255.0093 | NA |
| FMDB724 | 22156436 | NA | NA | GVSNAAVVAGGH | GVSNAAVVAGGH | 12 | kamut | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS66 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 1037.5254 | NA |
| FMDB725 | 22156436 | NA | NA | DAQEFKR | DAQEFKR | 7 | kamut | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS67 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 892.4403 | NA |
| FMDB726 | 22156436 | NA | NA | PPGPGPGPPPPPGAAGRGGGG | PPGPGPGPPPPPGAAGRGGGG | 21 | kamut | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS68 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 1704.8721 | NA |
| FMDB727 | 22156436 | NA | NA | HKEMQAIFDVYIMFIN | HKEMQAIFDVYIMFIN | 16 | kamut | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS69 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 2000.3734 | NA |
| FMDB728 | 22156436 | NA | NA | TGGGSTSSSSSSSSSLGGGASRGSVVEAAPPATQGAAAANAPAVPVVVVDTQEAGIR | TGGGSTSSSSSSSSSLGGGASRGSVVEAAPPATQGAAAANAPAVPVVVVDTQEAGIR | 57 | kamut | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS70 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 5124.5196 | NA |
| FMDB729 | 22156436 | NA | NA | DTAAGYVAPPDPAVSTGDYGLAGAEAPHPHESAVMSGAAAAAVAPGGEAYTR | DTAAGYVAPPDPAVSTGDYGLAGAEAPHPHESAVMSGAAAAAVAPGGEAYTR | 52 | kamut | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS71 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 4921.2889 | NA |
| FMDB739 | NA | | NA | APFPEVFGKEKVNEL | APFPEVFGKEKVNEL | 15 | fermented Milk ( lassi) | αS1-Casein | 4.6 | 37C | 10h | Antioxidant | NA | NA | NA | L.acidophilus NCDC-15,Lactococcus lactis NCDC-167 and S. thermophilus | Cell envelope protease | nano HPLCTRAPMS | NA | 1702.98 | NA |
| FMDB744 | NA | | NA | EPVLGPVRGPFP | EPVLGPVRGPFP | 12 | fermented Milk ( lassi) | β-Casein | 4.6 | 37C | 10h | Immunomodulatory;Antioxidant;Anti-microbial | NA | NA | NA | L.acidophilus NCDC-15,Lactococcus lactis NCDC-167 and S. thermophilus | Cell envelope protease | nano HPLCTRAPMS | NA | 1263.69 | NA |
| FMDB745 | NA | | NA | EPVLGPVRGPFPI | EPVLGPVRGPFPI | 13 | fermented Milk ( lassi) | β-Casein | 4.6 | 37C | 10h | Immunomodulatory;Antioxidant;Anti-microbial | NA | NA | NA | L.acidophilus NCDC-15,Lactococcus lactis NCDC-167 and S. thermophilus | Cell envelope protease | nano HPLCTRAPMS | NA | 1376.94 | NA |
| FMDB747 | NA | | NA | GVSKVKEAMAPKH | GVSKVKEAMAPKH | 13 | fermented Milk ( lassi) | β-Casein | 4.6 | 37C | 10h | Antioxidant | NA | NA | NA | L.acidophilus NCDC-15,Lactococcus lactis NCDC-167 and S. thermophilus | Cell envelope protease | nano HPLCTRAPMS | NA | 1380.84 | NA |
| FMDB749 | NA | | NA | KVLPVPQK | KVLPVPQK | 8 | fermented Milk ( lassi) | β-Casein | 4.6 | 37C | 10h | Antioxidant;Anti-hypertensive | NA | NA | NA | L.acidophilus NCDC-15,Lactococcus lactis NCDC-167 and S. thermophilus | Cell envelope protease | nano HPLCTRAPMS | NA | 907.63 | NA |
| FMDB762 | NA | | NA | QEPVLGPVRGPFPIIV | QEPVLGPVRGPFPIIV | 16 | fermented Milk ( lassi) | β-Casein | 4.6 | 37C | 10h | Ace-inhibitory;Antioxidant;Anti-microbial | In vitro | NA | spectrophotometric assay using HHL as substrate | L.acidophilus NCDC-15,Lactococcus lactis NCDC-167 and S. thermophilus | Cell envelope protease | nano HPLCTRAPMS | NA | 1717.07 | NA |
| FMDB763 | NA | | NA | SKVLPVPQKAVPYPQ | SKVLPVPQKAVPYPQ | 15 | fermented Milk ( lassi) | β-Casein | 4.6 | 37C | 10h | Antioxidant;Anti-microbial | NA | NA | NA | L.acidophilus NCDC-15,Lactococcus lactis NCDC-167 and S. thermophilus | Cell envelope protease | nano HPLCTRAPMS | NA | 1651.04 | NA |
| FMDB774 | NA | | NA | YQEPVLGPVRGPFPIIV | YQEPVLGPVRGPFPIIV | 17 | fermented Milk ( lassi) | β-Casein | 4.6 | 37C | 10h | Ace-inhibitory;Antioxidant;Immunomodulatory;Anti-microbial | In vitro | NA | spectrophotometric assay using HHL as substrate | L.acidophilus NCDC-15,Lactococcus lactis NCDC-167 and S. thermophilus | Cell envelope protease | nano HPLCTRAPMS | NA | 1880.2 | NA |
| FMDB969 | NA | ledesma05 | Identification of antioxidant and ACE-inhibitory peptides in fermented Milk | KVLPVPQ | KVLPVPQ | 7 | WSE of commercial fermented Milk spain | β-Casein | NA | NA | NA | Ace-inhibitory;Antioxidant | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | NA | NA | RP-HPLC– tandem mass spectrometry (MS/MS) | NA | 779.6 | 39 μM |
| FMDB972 | NA | ledesma05 | Identification of antioxidant and ACE-inhibitory peptides in fermented Milk | VAPFPGVFGK | VAPFPGVFGK | 10 | WSE of commercial fermented Milk spain | αS1-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | NA | NA | RP-HPLC– tandem mass spectrometry (MS/MS) | NA | 1089.5 | NA |
| FMDB974 | NA | ledesma05 | Identification of antioxidant and ACE-inhibitory peptides in fermented Milk | HLPLPL | HLPLPL | 6 | WSE of commercial fermented Milk spain | β-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | NA | NA | RP-HPLC– tandem mass spectrometry (MS/MS) | NA | 688.5 | NA |
| FMDB977 | NA | ledesma05 | Identification of antioxidant and ACE-inhibitory peptides in fermented Milk | GPVRGPFPII | GPVRGPFPII | 10 | WSE of commercial fermented Milk spain | β-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | NA | NA | RP-HPLC– tandem mass spectrometry (MS/MS) | NA | 1051.5 | NA |
| FMDB979 | NA | ledesma05 | Identification of antioxidant and ACE-inhibitory peptides in fermented Milk | NQE | NQE | 3 | WSE of commercial fermented Milk spain | k-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | NA | NA | RP-HPLC– tandem mass spectrometry (MS/MS) | NA | 389.2 | NA |
| FMDB981 | NA | ledesma05 | Identification of antioxidant and ACE-inhibitory peptides in fermented Milk | AKYIPIQYVLSRYPSY | AKYIPIQYVLSRYPSY | 16 | WSE of commercial fermented Milk spain | k-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | NA | NA | RP-HPLC– tandem mass spectrometry (MS/MS) | NA | 1959.4 | NA |
| FMDB983 | NA | ledesma05 | Identification of antioxidant and ACE-inhibitory peptides in fermented Milk | IPIQYVL | IPIQYVL | 7 | WSE of commercial fermented Milk spain | k-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | NA | NA | RP-HPLC– tandem mass spectrometry (MS/MS) | NA | 844.6 | NA |
| FMDB985 | NA | ledesma05 | Identification of antioxidant and ACE-inhibitory peptides in fermented Milk | PPK | PPK | 3 | WSE of commercial fermented Milk spain | k-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | NA | NA | RP-HPLC– tandem mass spectrometry (MS/MS) | NA | 340.2 | NA |
| FMDB986 | NA | rhee04 | Potential Antioxidant Peptides in Rice wine | IHH | IHH | 3 | Rice wine | NA | NA | 5-10c | 3months | Antioxidant | NA | NA | Free Radical Scavenging Activity By DPPH method | Nuruk as starter | NA | Edman degradation using protein sequencer with an HPLC system | NA | NA | NA |
| FMDB987 | NA | | Potential Antioxidant Peptides in Rice wine | VVH/N | VVH/N | 5 | Rice wine | NA | NA | 5-10c | 3months | Antioxidant | NA | NA | Free Radical Scavenging Activity By DPPH method | Nuruk as starter | NA | Edman degradation using protein sequencer with an HPLC system | NA | NA | NA |
| FMDB988 | NA | | Potential Antioxidant Peptides in Rice wine | LVP | LVP | 3 | Rice wine | NA | NA | 5-10c | 3months | Antioxidant | NA | NA | Free Radical Scavenging Activity By DPPH method | Nuruk as starter | NA | Edman degradation using protein sequencer with an HPLC system | NA | NA | NA |
| FMDB989 | NA | | Potential Antioxidant Peptides in Rice wine | L/VKRP | L/VKRP | 6 | Rice wine | NA | NA | 5-10c | 3months | Antioxidant | NA | NA | Free Radical Scavenging Activity By DPPH method | Nuruk as starter | NA | Edman degradation using protein sequencer with an HPLC system | NA | NA | NA |
| FMDB1023 | 22783093 | NA | NA | LAGNGRSVGVEYV | LAGNGRSVGVEYV | 13 | vitis hybrid red wine made from Vitis hybrid–Vitis coignetiae must | NA | NA | 25C | 10days | Ace-inhibitory;Antioxidant | In vitro | NA | Spectrophotometric assay using HHL as substrate;Antioxidant by DPPH | S. cerevisiae KCTC 7904 | NA | NA | NA | NA | NA |
| FMDB1024 | 22783093 | NA | NA | ATQVPLVSSTSEGYTASQPLYQP | ATQVPLVSSTSEGYTASQPLYQP | 23 | vitis hybrid red wine made from Vitis hybrid–Vitis coignetiae must | NA | NA | 25C | 10days | Ace-inhibitory;Antioxidant | In vitro | NA | Spectrophotometric assay using HHL as substrate;Antioxidant by DPPH | S. cerevisiae KCTC 7904 | NA | NA | NA | NA | NA |
| FMDB1025 | 22783093 | NA | NA | NPADLPDAG | NPADLPDAG | 9 | vitis hybrid red wine made from Vitis hybrid–Vitis coignetiae must | NA | NA | 25C | 10days | Ace-inhibitory;Antioxidant | In vitro | NA | Spectrophotometric assay using HHL as substrate;Antioxidant by DPPH | S. cerevisiae KCTC 7904 | NA | NA | NA | NA | NA |
| FMDB1026 | 22783093 | NA | NA | TRHNIGFAAVDALARAWNISLA | TRHNIGFAAVDALARAWNISLA | 22 | vitis hybrid red wine made from Vitis hybrid–Vitis coignetiae must | NA | NA | 25C | 10days | Ace-inhibitory;Antioxidant | In vitro | NA | Spectrophotometric assay using HHL as substrate;Antioxidant by DPPH | S. cerevisiae KCTC 7904 | NA | NA | NA | NA | NA |
| FMDB1027 | 22783093 | NA | NA | TTTAATS | TTTAATS | 7 | vitis hybrid red wine made from Vitis hybrid–Vitis coignetiae must | NA | NA | 25C | 10days | Ace-inhibitory;Antioxidant | In vitro | NA | Spectrophotometric assay using HHL as substrate;Antioxidant by DPPH | S. cerevisiae KCTC 7904 | NA | NA | NA | NA | NA |
| FMDB1028 | 22783093 | NA | NA | REGAAPGAA | REGAAPGAA | 9 | vitis hybrid red wine made from Vitis hybrid–Vitis coignetiae must | NA | NA | 25C | 10days | Ace-inhibitory;Antioxidant | In vitro | NA | Spectrophotometric assay using HHL as substrate;Antioxidant by DPPH | S. cerevisiae KCTC 7904 | NA | NA | NA | NA | NA |
| FMDB1196 | 25218972 | NA | NA | LAFNPTQLEGQCHV | LAFNPTQLEGQCHV | 14 | Sheep cheese Whey | ovine βlactoglobulin, f(149–162) | NA | 45c | 4h | Antioxidant | In vitro | NA | ABTS radical scavenging assay | Bacillus sp.P7 | protease | nano-ESI-MS | 778.8811 | NA | NA |
| FMDB1292 | NA | farvin10 | Antioxidant activity of Yogurt peptides: Part 2 – Characterisation of peptide fractions | QQQTED | QQQTED | 6 | fish oil enriched Yogurt | β-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Assay by DPPH radicalscavenging | NA | NA | LC-MS/MS | NA | 748 | NA |
| FMDB1293 | NA | farvin10 | NA | NSKKTVD | NSKKTVD | 7 | fish oil enriched Yogurt | αS2-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Assay by DPPH radicalscavenging | NA | NA | LC-MS/MS | NA | 791.4 | NA |
| FMDB1294 | NA | farvin10 | NA | YP | YP | 2 | fish oil enriched Yogurt | β-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Assay by DPPH radicalscavenging | NA | NA | LC-MS/MS | NA | 279 | NA |
| FMDB1295 | NA | farvin10 | NA | YAKPA | YAKPA | 5 | fish oil enriched Yogurt | k-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Assay by DPPH radicalscavenging | NA | NA | LC-MS/MS | NA | 549.2 | NA |
| FMDB1296 | NA | farvin10 | NA | TVQVT | TVQVT | 5 | fish oil enriched Yogurt | k-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Assay by DPPH radicalscavenging | NA | NA | LC-MS/MS | NA | 547.2 | NA |
| FMDB1297 | NA | farvin10 | NA | TVQVTST | TVQVTST | 7 | fish oil enriched Yogurt | k-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Assay by DPPH radicalscavenging | NA | NA | LC-MS/MS | NA | 735.4 | NA |
| FMDB1298 | NA | farvin10 | NA | VPYPQ | VPYPQ | 5 | fish oil enriched Yogurt | β-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Assay by DPPH radicalscavenging | NA | NA | LC-MS/MS | NA | 603.3 | NA |
| FMDB1299 | NA | farvin10 | NA | PIGSENS | PIGSENS | 7 | fish oil enriched Yogurt | αS1-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Assay by DPPH radicalscavenging | NA | NA | LC-MS/MS | NA | 703.4 | NA |
| FMDB1300 | NA | farvin10 | NA | KAVPYPQ | KAVPYPQ | 7 | fish oil enriched Yogurt | β-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Assay by DPPH radicalscavenging | NA | NA | LC-MS/MS | NA | 802.5 | NA |
| FMDB1301 | NA | farvin10 | NA | TVQVTSTAV | TVQVTSTAV | 9 | fish oil enriched Yogurt | k-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Assay by DPPH radicalscavenging | NA | NA | LC-MS/MS | NA | 905.5 | NA |
| FMDB1302 | NA | farvin10 | NA | IESPPEIN | IESPPEIN | 8 | fish oil enriched Yogurt | k-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Assay by DPPH radicalscavenging | NA | NA | LC-MS/MS | NA | 898.3 | NA |
| FMDB1303 | NA | farvin10 | NA | NVPGEIVE | NVPGEIVE | 8 | fish oil enriched Yogurt | β-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Assay by DPPH radicalscavenging | NA | NA | LC-MS/MS | NA | 856.4 | NA |
| FMDB1304 | NA | farvin10 | NA | VIESPPEIN | VIESPPEIN | 9 | fish oil enriched Yogurt | k-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Assay by DPPH radicalscavenging | NA | NA | LC-MS/MS | NA | 997.6 | NA |
| FMDB1305 | NA | farvin10 | NA | KVLPVPE | KVLPVPE | 7 | fish oil enriched Yogurt | β-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Assay by DPPH radicalscavenging | NA | NA | LC-MS/MS | NA | 780.6 | NA |
| FMDB1306 | NA | farvin10 | NA | GVRGPFPII | GVRGPFPII | 9 | fish oil enriched Yogurt | β-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Assay by DPPH radicalscavenging | NA | NA | LC-MS/MS | NA | 996.3 | NA |
| FMDB1307 | NA | farvin10 | NA | DKIHPF | DKIHPF | 6 | fish oil enriched Yogurt | β-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Assay by DPPH radicalscavenging | NA | NA | LC-MS/MS | NA | 756.3 | NA |
| FMDB1308 | NA | farvin10 | NA | IPIQY | IPIQY | 5 | fish oil enriched Yogurt | k-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Assay by DPPH radicalscavenging | NA | NA | LC-MS/MS | NA | 633.3 | NA |
| FMDB1309 | NA | farvin10 | NA | VFGKEKVNEL | VFGKEKVNEL | 10 | fish oil enriched Yogurt | αS1-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Assay by DPPH radicalscavenging | NA | NA | LC-MS/MS | NA | 1162.7 | NA |
| FMDB1310 | NA | farvin10 | NA | ELQDKIHPF | ELQDKIHPF | 9 | fish oil enriched Yogurt | β-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Assay by DPPH radicalscavenging | NA | NA | LC-MS/MS | NA | 1126.6 | NA |
| FMDB1311 | NA | farvin10 | NA | YPFPGPIPN | YPFPGPIPN | 9 | fish oil enriched Yogurt | β-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Assay by DPPH radicalscavenging | NA | NA | LC-MS/MS | NA | 1001.6 | NA |
| FMDB1312 | NA | farvin10 | NA | QQPVLGPVRGPFP | QQPVLGPVRGPFP | 13 | fish oil enriched Yogurt | β-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Assay by DPPH radicalscavenging | NA | NA | LC-MS/MS | NA | 1392.9 | NA |
| FMDB1313 | NA | farvin10 | NA | HKEMPFPKYPVQPF | HKEMPFPKYPVQPF | 14 | fish oil enriched Yogurt | β-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Assay by DPPH radicalscavenging | NA | NA | LC-MS/MS | NA | 1746.9 | NA |
| FMDB1314 | NA | farvin10 | NA | MAPKHKEMPFPKYPVQPF | MAPKHKEMPFPKYPVQPF | 18 | fish oil enriched Yogurt | β-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Assay by DPPH radicalscavenging | NA | NA | LC-MS/MS | NA | 2173.2 | NA |
| FMDB1315 | NA | farvin10 | NA | LVYPFPGPIPN | LVYPFPGPIPN | 11 | fish oil enriched Yogurt | β-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Assay by DPPH radicalscavenging | NA | NA | LC-MS/MS | NA | 1213.6 | NA |
| FMDB1316 | NA | farvin10 | NA | SLVYPFPGPIPN | SLVYPFPGPIPN | 12 | fish oil enriched Yogurt | β-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Assay by DPPH radicalscavenging | NA | NA | LC-MS/MS | NA | 1300.6 | NA |
| FMDB1317 | NA | farvin10 | NA | MPFPKYPVQPF | MPFPKYPVQPF | 11 | fish oil enriched Yogurt | β-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Assay by DPPH radicalscavenging | NA | NA | LC-MS/MS | NA | 1351.6 | NA |
| FMDB1318 | NA | farvin10 | NA | TQTPVVVPPFLQPE | TQTPVVVPPFLQPE | 14 | fish oil enriched Yogurt | β-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Assay by DPPH radicalscavenging | NA | NA | LC-MS/MS | NA | 1552.4 | NA |
| FMDB1319 | NA | farvin10 | NA | YQQPVLGPVRGPFPII | YQQPVLGPVRGPFPII | 16 | fish oil enriched Yogurt | β-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Assay by DPPH radicalscavenging | NA | NA | LC-MS/MS | NA | 1782.1 | NA |
| FMDB1320 | NA | farvin10 | NA | RDMPIQAFLL | RDMPIQAFLL | 10 | fish oil enriched Yogurt | β-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Assay by DPPH radicalscavenging | NA | NA | LC-MS/MS | NA | 1203.7 | NA |
| FMDB1321 | NA | farvin10 | NA | QQPVLGPVRGPFPIIV | QQPVLGPVRGPFPIIV | 16 | fish oil enriched Yogurt | β-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Assay by DPPH radicalscavenging | NA | NA | LC-MS/MS | NA | 1719 | NA |
| FMDB1322 | NA | farvin10 | NA | YQQPVLGPVRGPFPIIV | YQQPVLGPVRGPFPIIV | 17 | fish oil enriched Yogurt | β-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Assay by DPPH radicalscavenging | NA | NA | LC-MS/MS | NA | 1882.1 | NA |
| FMDB1323 | NA | farvin10 | NA | MAPKHEMPFPKYP | MAPKHEMPFPKYP | 13 | fish oil enriched Yogurt | β-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Assay by DPPH radicalscavenging | NA | NA | LC-MS/MS | NA | 1701.5 | NA |
| FMDB1324 | NA | farvin10 | NA | SLPQNIPPLTQTPVVVPFLQPEVM | SLPQNIPPLTQTPVVVPFLQPEVM | 24 | fish oil enriched Yogurt | β-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Assay by DPPH radicalscavenging | NA | NA | LC-MS/MS | NA | 2742.2 | NA |
| FMDB1325 | NA | farvin10 | NA | NIPPLTQTPVVVPFLQPEVM | NIPPLTQTPVVVPFLQPEVM | 20 | fish oil enriched Yogurt | β-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Assay by DPPH radicalscavenging | NA | NA | LC-MS/MS | NA | 2317.2 | NA |
| FMDB1574 | NA | meira12 | Bioactive peptides in water-soluble extracts of ovine cheeses from Southern Brazil and Uruguay | KEMPFPKYPVE | KEMPFPKYPVE | 11 | WSE of Roquefort type cheese | β-Casein | NA | 31-33 c coking temp. | 90days of ripening | Anti-hypertensive;Antioxidant | In vitro | NA | spectrophotometric assay using HHL as substrate and DPPH radical scavenging activity | NA | NA | nano-ESI tandem mass spectrometry (MS/MS) | 682.840 +2 | 1363.68 | NA |
| FMDB1575 | NA | meira12 | Bioactive peptides in water-soluble extracts of ovine cheeses from Southern Brazil and Uruguay | WMHQPPQPLPPTVMFPPQSVL | WMHQPPQPLPPTVMFPPQSVL | 21 | WSE of Roquefort type cheese | β-Casein | NA | 31-33 c coking temp. | 90days of ripening | Anti-hypertensive;Antioxidant | In vitro | NA | spectrophotometric assay using HHL as substrate and DPPH radical scavenging activity | NA | NA | nano-ESI tandem mass spectrometry (MS/MS) | 1214.088+2 | 2426.18 | NA |
| FMDB1576 | NA | meira12 | Bioactive peptides in water-soluble extracts of ovine cheeses from Southern Brazil and Uruguay | MHQPPQPLPPTVMFPPQSVL | MHQPPQPLPPTVMFPPQSVL | 20 | WSE of Roquefort type cheese | β-Casein | NA | 31-33 c coking temp. | 90days of ripening | Anti-hypertensive;Antioxidant | In vitro | NA | spectrophotometric assay using HHL as substrate and DPPH radical scavenging activity | NA | NA | nano-ESI tandem mass spectrometry (MS/MS) | 1121.057+2 | 2240.11 | NA |
| FMDB1577 | NA | meira12 | Bioactive peptides in water-soluble extracts of ovine cheeses from Southern Brazil and Uruguay | HQPPQPLPPTVMFPPQSVL | HQPPQPLPPTVMFPPQSVL | 19 | WSE of Roquefort type cheese | β-Casein | NA | 31-33 c coking temp. | 90days of ripening | Anti-hypertensive;Antioxidant;Anti-microbial | In vitro | NA | spectrophotometric assay using HHL as substrate and DPPH radical scavenging activity | NA | NA | nano-ESI tandem mass spectrometry (MS/MS) | 1055.544+2 | 2109.09 | NA |
| FMDB1578 | NA | meira12 | Bioactive peptides in water-soluble extracts of ovine cheeses from Southern Brazil and Uruguay | YQEPVLGPVRGPFPI | YQEPVLGPVRGPFPI | 15 | WSE of Roquefort type cheese | β-Casein | NA | 31-33 c coking temp. | 90days of ripening | Anti-hypertensive;Antioxidant;Anti-microbial | In vitro | NA | spectrophotometric assay using HHL as substrate and DPPH radical scavenging activity | NA | NA | nano-ESI tandem mass spectrometry (MS/MS) | 834.880 +2 | 1667.76 | NA |
| FMDB1579 | NA | meira12 | Bioactive peptides in water-soluble extracts of ovine cheeses from Southern Brazil and Uruguay | QEPVLGPVRGPFPILV | QEPVLGPVRGPFPILV | 16 | WSE of Roquefort type cheese | β-Casein | NA | 31-33 c coking temp. | 90days of ripening | Anti-hypertensive;Antioxidant | In vitro | NA | spectrophotometric assay using HHL as substrate and DPPH radical scavenging activity | NA | NA | nano-ESI tandem mass spectrometry (MS/MS) | 859.491 +2 | 1716.98 | NA |
| FMDB1580 | NA | meira12 | Bioactive peptides in water-soluble extracts of ovine cheeses from Southern Brazil and Uruguay | QEPVLGPVRGPFPI | QEPVLGPVRGPFPI | 14 | WSE of Roquefort type cheese | β-Casein | NA | 31-33 c coking temp. | 90days of ripening | Anti-hypertensive;Antioxidant | In vitro | NA | spectrophotometric assay using HHL as substrate and DPPH radical scavenging activity | NA | NA | nano-ESI tandem mass spectrometry (MS/MS) | 753.416 +2 | 1504.83 | NA |
| FMDB1581 | NA | meira12 | Bioactive peptides in water-soluble extracts of ovine cheeses from Southern Brazil and Uruguay | PVLGPVRGPFPI | PVLGPVRGPFPI | 12 | WSE of Roquefort type cheese | β-Casein | NA | 31-33 c coking temp. | 90days of ripening | Anti-hypertensive;Antioxidant | In vitro | NA | spectrophotometric assay using HHL as substrate and DPPH radical scavenging activity | NA | NA | nano-ESI tandem mass spectrometry (MS/MS) | 624.847+ 2 | 1247.69 | NA |
| FMDB1582 | NA | meira12 | Bioactive peptides in water-soluble extracts of ovine cheeses from Southern Brazil and Uruguay | LGPVRGPFPI | LGPVRGPFPI | 10 | WSE of Roquefort type cheese | β-Casein | NA | 31-33 c coking temp. | 90days of ripening | Anti-hypertensive;Antioxidant | In vitro | NA | spectrophotometric assay using HHL as substrate and DPPH radical scavenging activity | NA | NA | nano-ESI tandem mass spectrometry (MS/MS) | 526.808 +2 | 1051.61 | NA |
| FMDB1583 | NA | meira12 | Bioactive peptides in water-soluble extracts of ovine cheeses from Southern Brazil and Uruguay | TDAPSFSDIPNPIGSENSGK | TDAPSFSDIPNPIGSENSGK | 20 | WSE of Roquefort type cheese | αS1-Casein | NA | 31-33 c coking temp. | 90days of ripening | Anti-hypertensive;Antioxidant | In vitro | NA | spectrophotometric assay using HHL as substrate and DPPH radical scavenging activity | NA | NA | nano-ESI tandem mass spectrometry (MS/MS) | 1016.976+2 | 2031.95 | NA |
| FMDB1584 | NA | meira12 | Bioactive peptides in water-soluble extracts of ovine cheeses from Southern Brazil and Uruguay | DIPNPIGSENSGKTTMPLW | DIPNPIGSENSGKTTMPLW | 19 | WSE of Roquefort type cheese | αS1-Casein | NA | 31-33 c coking temp. | 90days of ripening | Anti-hypertensive;Antioxidant;Anti-microbial | In vitro | NA | spectrophotometric assay using HHL as substrate and DPPH radical scavenging activity | NA | NA | nano-ESI tandem mass spectrometry (MS/MS) | 1028.993+2 | 2055.98 | NA |
| FMDB1585 | NA | meira12 | Bioactive peptides in water-soluble extracts of ovine cheeses from Southern Brazil and Uruguay | IPNPIGSENSGKIT | IPNPIGSENSGKIT | 14 | WSE of Roquefort type cheese | αS1-Casein | NA | 31-33 c coking temp. | 90days of ripening | Anti-hypertensive;Antioxidant | In vitro | NA | spectrophotometric assay using HHL as substrate and DPPH radical scavenging activity | NA | NA | nano-ESI tandem mass spectrometry (MS/MS) | 713.872 +2 | 1425.74 | NA |
| FMDB1586 | NA | meira12 | Bioactive peptides in water-soluble extracts of ovine cheeses from Southern Brazil and Uruguay | NAGPFTPTVNR | NAGPFTPTVNR | 11 | WSE of Roquefort type cheese | αS2-Casein | NA | 31-33 c coking temp. | 90days of ripening | Anti-hypertensive;Antioxidant | In vitro | NA | spectrophotometric assay using HHL as substrate and DPPH radical scavenging activity | NA | NA | nano-ESI tandem mass spectrometry (MS/MS) | 587.320 +2 | 1172.62 | NA |
| FMDB1587 | NA | meira12 | Bioactive peptides in water-soluble extracts of ovine cheeses from Southern Brazil and Uruguay | YQGPIVLNPWDQVKR | YQGPIVLNPWDQVKR | 15 | WSE of Roquefort type cheese | αS2-Casein | NA | 31-33 c coking temp. | 90days of ripening | Anti-hypertensive;Antioxidant | In vitro | NA | spectrophotometric assay using HHL as substrate and DPPH radical scavenging activity | NA | NA | nano-ESI tandem mass spectrometry (MS/MS) | 604.993+ 3 | 1811.96 | NA |
| FMDB1588 | NA | meira12 | Bioactive peptides in water-soluble extracts of ovine cheeses from Southern Brazil and Uruguay | YQGPIVLNPWDQVK | YQGPIVLNPWDQVK | 14 | WSE of Roquefort type cheese | αS2-Casein | NA | 31-33 c coking temp. | 90days of ripening | Anti-hypertensive;Antioxidant | In vitro | NA | spectrophotometric assay using HHL as substrate and DPPH radical scavenging activity | NA | NA | nano-ESI tandem mass spectrometry (MS/MS) | 828.895 +2 | 1655.78 | NA |
| FMDB1589 | NA | meira12 | Bioactive peptides in water-soluble extracts of ovine cheeses from Southern Brazil and Uruguay | GPIVLNPWDQVKR | GPIVLNPWDQVKR | 13 | WSE of Roquefort type cheese | αS2-Casein | NA | 31-33 c coking temp. | 90days of ripening | Anti-hypertensive;Antioxidant | In vitro | NA | spectrophotometric assay using HHL as substrate and DPPH radical scavenging activity | NA | NA | nano-ESI tandem mass spectrometry (MS/MS) | 761.428+ 2 | 1520.86 | NA |
| FMDB1590 | NA | meira12 | Bioactive peptides in water-soluble extracts of ovine cheeses from Southern Brazil and Uruguay | VLNPWDQVKR | VLNPWDQVKR | 10 | WSE of Roquefort type cheese | αS2-Casein | NA | 31-33 c coking temp. | 90days of ripening | Anti-hypertensive;Antioxidant | In vitro | NA | spectrophotometric assay using HHL as substrate and DPPH radical scavenging activity | NA | NA | nano-ESI tandem mass spectrometry (MS/MS) | 627.840 +2 | 1253.68 | NA |
| FMDB1756 | 26616950;1169462 | NA | NA | YQEPVLGPVRGPFPIIV | YQEPVLGPVRGPFPIIV | 17 | Casein (raw Milk) | Casecidin-17 | NA | 23 C and then at 4c | 24 h +24h | Anti-microbial;Antithrombotic;Immunomodulatory;Antioxidant | NA | NA | NA | NA | Proteases | NA | NA | NA | NA |
| FMDB1757 | 26616950;1169462 | NA | NA | YQEPVLGPVRGPFPIIV | YQEPVLGPVRGPFPIIV | 17 | Casein (Heat treated Milk with open vials) | Casecidin-17 | NA | 23 C and then at 4c | 24 h +24h | Anti-microbial;Antithrombotic;Immunomodulatory;Antioxidant | NA | NA | NA | NA | Proteases | NA | NA | NA | NA |
| FMDB1758 | 26616950;1169462 | NA | NA | YQEPVLGPVRGPFPIIV | YQEPVLGPVRGPFPIIV | 17 | Casein (Heat treated Milk with closed vials) | Casecidin-17 | NA | 23 C and then at 4c | 24 h +24h | Anti-microbial;Antithrombotic;Immunomodulatory;Antioxidant | NA | NA | NA | NA | Proteases | NA | NA | NA | NA |
| FMDB1759 | 26616950;1169462 | NA | NA | YQEPVLGPVRGPFPIIV | YQEPVLGPVRGPFPIIV | 17 | Casein (Kefir) | Casecidin-17 | NA | 23 C and then at 4c | 24 h +24h | Anti-microbial;Antithrombotic;Immunomodulatory;Antioxidant | NA | NA | NA | Kefir grains(Lactobacillus,Lactococcus, Leuconostoc ,Streptococcus Saccharomyces, Candida, Kluyveromyces, Debaryomyces and Torulaspora) | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1782 | 26616950 | NA | NA | VYPFPGPIPN | VYPFPGPIPN | 10 | Casein (Kefir) | V-b-casomorphin-9 | NA | 23 C and then at 4c | 24 h +24h | Antioxidant | NA | NA | NA | Kefir grains(Lactobacillus,Lactococcus, Leuconostoc ,Streptococcus Saccharomyces, Candida, Kluyveromyces, Debaryomyces and Torulaspora) | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1966 | NA | amadou13 | Purification and characterization of foxtail millet-derived peptides with antioxidant and antimicrobial activities | SGYYMH | SGYYMH | 6 | defatted foxtail millet meal | NA | NA | 37c | 48h | Antioxidant | In vitro | NA | DPPH scavenging activityand the superoxide anion (O2 •−) scavenging activity | L. paracasei Fn032 | NA | HPLC MALDI–TOF–TOF MS | NA | 756.84 da | NA |
| FMDB1967 | NA | amadou13 | Purification and characterization of foxtail millet-derived peptides with antioxidant and antimicrobial activities | LGTFQN | LGTFQN | 6 | defatted foxtail millet meal | NA | NA | 37c | 48h | Antioxidant | In vitro | NA | DPPH scavenging activityand the superoxide anion (O2 •−) scavenging activity | L. paracasei Fn032 | NA | HPLC MALDI–TOF–TOF MS | NA | 678.74 Da | NA |
| FMDB1968 | NA | amadou13 | Purification and characterization of foxtail millet-derived peptides with antioxidant and antimicrobial activities | LHALLL | LHALLL | 6 | defatted foxtail millet meal | NA | NA | 37c | 48h | Antioxidant | In vitro | NA | DPPH scavenging activityand the superoxide anion (O2 •−) scavenging activity | L. paracasei Fn032 | NA | HPLC MALDI–TOF–TOF MS | NA | 678.87 Da | NA |
| FMDB2090 | 23871374;15030202 | NA | NA | VLSLSQSKVLPVPQK | VLSLSQSKVLPVPQK | 15 | Casein | β-Casein | 7 | 37c | 48h | Antioxidant | In vitro | NA | ABTS radical scavenging activity and total phenolic content measurement | Bifidobacterium longum KACC91563 | peptidase | LC-nano ESI-MS/MS | 541.6613+3 | 1621.9622 | NA |
| FMDB2092 | 23871374;15030202 | NA | NA | VLSLSQSKVLPVPQKAVPYPQRDMPIQA | VLSLSQSKVLPVPQKAVPYPQRDMPIQA | 28 | Casein | β-Casein | 7 | 37c | 48h | Antioxidant | In vitro | NA | ABTS radical scavenging activity and total phenolic content measurement | Bifidobacterium longum KACC91563 | peptidase | LC-nano ESI-MS/MS | 777.1820+4 | 3104.699 | NA |
| FMDB2119 | NA | NA | NA | VKEAMAPK | VKEAMAPK | 8 | Cheddar cheese | β-Casein | NA | NA | NA | Antioxidant | In vitro | NA | NA | Lactobacillus casei ssp. casei 300 | NA | LC-MS/MS | NA | 872.5048 | NA |
| FMDB2120 | NA | NA | NA | HIQKEDVPSER | HIQKEDVPSER | 11 | Cheddar cheese | αS1-Casein | NA | NA | NA | Antioxidant | In vitro | NA | NA | Lactobacillus casei ssp. casei 300 | NA | LC-MS/MS | NA | 1336.7034 | NA |
| FMDB2121 | NA | NA | NA | ARHPHPHLSFM | ARHPHPHLSFM | 11 | Skimmed Milk | k-Casein | NA | NA | NA | Antioxidant | In vitro | NA | NA | Lactobacillus delbrueckii subsp. bulgaricus IFO13953 | NA | mass spectrograph & amino acid sequencer | NA | NA | NA |