Browse result page of AntiTbPdb
The total number entries retrieved from this search are 124
| ID | Name | Sequence | N-Terminal Modification | C-Terminal Modification | Chemical Modification | Linear/Cyclic | Length | Chirality | Nature | Source | Origin | Species | Strain | Inhibition Concentration | In vitro/ In vivo | Cell Line | Intracellular Inhibition | Cytotoxicity | Animal Model | Effective Dose in model organism | Immune Responce | Mechanism of Action | Target | Combination Therapy | Other Activities | Year of Publication | Pubmed ID/ Patent No. |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| antitb_1640 | Callyaerins 7 | I-(Hyp)-VILPPLPIFG | Free | Amidation | Hyp= Hydroxiproline, Residue 1-8 involved in cyclic bond formation | Cyclic | 11 | D | Cationic | Natural | Derived from Callyspongia aerizusa | NA | NA | IC50= 2 μg/ml | in vitro | MRC-5 cell lines | 50% reduction in bacterial load | NA | NA | NA | NA | NA | NA | NA | NA | 2015 | 26213786 |
| antitb_1641 | Callyaerins 7 | I-(Hyp)-VILPPLPIFG | Free | Amidation | Hyp= Hydroxiproline, Residue 1-8 involved in cyclic bond formation | Cyclic | 11 | D | Cationic | Natural | Derived from Callyspongia aerizusa | NA | NA | I90C = 6 μg/ml | in vitro | MRC-5 cell lines | 90% reduction in bacterial load | NA | NA | NA | NA | NA | NA | NA | NA | 2015 | 26213786 |
| antitb_1642 | Callyaerins 8 | H-(Hyp)-LLPPVPLFG | Free | Amidation | Hyp= Hydroxiproline, Residue 1-8 involved in cyclic bond formation | Cyclic | 11 | D | Cationic | Natural | Derived from Callyspongia aerizusa | Mycobacterium Tuberculosis | Mycobacterium tuberculosis H37Rv | IC90= 40 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2015 | 26213786 |
| antitb_1643 | Callyaerins 8 | H-(Hyp)-LLPPVPLFG | Free | Amidation | Hyp= Hydroxiproline, Residue 1-8 involved in cyclic bond formation | Cyclic | 11 | D | Cationic | Natural | Derived from Callyspongia aerizusa | Mycobacterium Tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 100 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2015 | 26213786 |
| antitb_1644 | Callyaerins 8 | H-(Hyp)-LLPPVPLFG | Free | Amidation | Hyp= Hydroxiproline, Residue 1-8 involved in cyclic bond formation | Cyclic | 11 | D | Cationic | Natural | Derived from Callyspongia aerizusa | NA | NA | IC50= >100 μg/ml | in vitro | THP-1 cell line | 50% reduction in bacterial load | NA | NA | NA | NA | NA | NA | NA | NA | 2015 | 26213786 |
| antitb_1645 | Callyaerins 8 | H-(Hyp)-LLPPVPLFG | Free | Amidation | Hyp= Hydroxiproline, Residue 1-8 involved in cyclic bond formation | Cyclic | 11 | D | Cationic | Natural | Derived from Callyspongia aerizusa | NA | NA | IC90 = >100 μg/ml | in vitro | THP-1 cell line | 90% reduction in bacterial load | NA | NA | NA | NA | NA | NA | NA | NA | 2015 | 26213786 |
| antitb_1646 | Callyaerins 8 | H-(Hyp)-LLPPVPLFG | Free | Amidation | Hyp= Hydroxiproline, Residue 1-8 involved in cyclic bond formation | Cyclic | 11 | D | Cationic | Natural | Derived from Callyspongia aerizusa | NA | NA | IC50= >100 μg/ml | in vitro | MRC-5 cell lines | 50% reduction in bacterial load | NA | NA | NA | NA | NA | NA | NA | NA | 2015 | 26213786 |
| antitb_1647 | Callyaerins 8 | H-(Hyp)-LLPPVPLFG | Free | Amidation | Hyp= Hydroxiproline, Residue 1-8 involved in cyclic bond formation | Cyclic | 11 | D | Cationic | Natural | Derived from Callyspongia aerizusa | NA | NA | IC90 = 100 μg/ml | in vitro | MRC-5 cell lines | 90% reduction in bacterial load | NA | NA | NA | NA | NA | NA | NA | NA | 2015 | 26213786 |
| antitb_1672 | Lariatin A | GSQLVYRWVGHSNVIKGP | Free | Free | Alpha carbon of glutamine form amide bond with first glycine and gamma carbon of glutamine involved in side chain formation | Cyclic | 18 | D | Cationic | Natural | Rhodococcus jostii B0171 | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC607 | MIC = 10 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2007 | 17617692 |
| antitb_1674 | Wollamides 2 | WLL-allo-ING | NA | NA | Fourth amino acid is allolysine and form cyclic structure with 1st and 6th | Cyclic | 6 | D | Cationic | Natural | Streptomyces species MST-115088 | Mycobacterium bovis | Mycobacterium bovis BCG | NA | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial against staphylococcus aureus and bacillus subtilis | 2014 | 25229313 |
| antitb_1675 | Wollamides 5 | WLLVNG | Free | Free | NA | Cyclic | 6 | D | Cationic | Natural | Streptomyces species MST-115088 | Mycobacterium bovis | Mycobacterium bovis BCG | IC50 = 2.8 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial against staphylococcus aureus and bacillus subtilis | 2014 | 25229313 |
| antitb_1676 | Wollamides 6 | WLV-allo-ING | Free | Free | Fourth amino acid is allolysine and form cyclic structure with 1st and 6th | Cyclic | 6 | D | Cationic | Natural | Streptomyces species MST-115088 | Mycobacterium bovis | Mycobacterium bovis BCG | IC50 = 3.1 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial against staphylococcus aureus and bacillus subtilis | 2014 | 25229313 |
| antitb_1677 | Globomycin | not available | NA | NA | NA | Cyclic | 0 | D | Cationic | Natural | Derived from streptomyces halstedii 13912 | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC607 | MIC = >100 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial against bacillus sub!ills , E.coli, S.aureus Antifungal against Aspergillus oryzae SANK 11262, Candida albicans | 1977 | 353012 |
| antitb_1882 | Propeptin-2 | GYPWWDYRDLFGGHTFI | Involved in Cyclic bond formation between amino acid 1 and 9 | Free | None | Cyclic | 17 | D | NA | Natural | Isolated from Microbispora species SNA-115 | Mycobacterium phlei | Mycobacterium phlei IFO 3158 | 40 μg/disc | In vitro | NA | Treatment of infected Mycobacterium phlei with 40 μg/disc of Propeptin-2 decreased approximately 90% of the bacterial load in zone inhibition assay | NA | NA | NA | NA | NA | NA | None | Antibacterial against silkworm | 2007 | 17827663 |
| antitb_1883 | Propeptin | GYPWWDYRDLFGGHTFISP | Involved in Cyclic bond formation between amino acid 1 and 9 | Free | None | Cyclic | 19 | D | NA | Natural | Isolated from Microbispora species SNA-115 | Mycobacterium smegmatis | Mycobacterium smegmatis M341 | MIC90 = 100 μg/mL | In vivo | NA | Treatment of infected Mycobacterium smegmatis with 100 μg/ml of Propeptin decreased approximately 90% of the bacterial load | NA | Silkworm hemolymph infected with mycobacterium smegmatis at (1.25 × 107 CFU) | 1.25 × 107 CFU | NA | NA | NA | None | None | 2017 | 28446822 |
| antitb_1884 | Trichoderins A | PXXXIVXX | Addition of MDA (2-methyl decanoic acid) | Addition of AMAE (2-[(20-aminopropyl) methylamino] ethanol) | Addition of AHMOD at residue 2 (2-amino-6-hydroxy-4-methyl-8-oxodecanoic acid) and AIB (a-aminoisobutyric acid) at 3,4,7, and 8 | Cyclic | 8 | D | NA | Natural | Isolated from Trichoderma species 05FI48 | Mycobacterium smegmatis | Mycobacterium smegmatis | MIC = 0.1 μg/mL | In vitro | NA | Tratment with this concentration inhibit 100% bacterial growth | NA | NA | NA | NA | NA | Lipid bilayer | NA | NA | 2010 | 20483615 |
| antitb_1885 | Trichoderins A | PXXXIVXX | Addition of MDA (2-methyl decanoic acid) | Addition of AMAE (2-[(20-aminopropyl) methylamino] ethanol) | Addition of AHMOD at residue 2 (2-amino-6-hydroxy-4-methyl-8-oxodecanoic acid) and AIB (a-aminoisobutyric acid) at 3,4,7, and 8 | Cyclic | 8 | D | NA | Natural | Isolated from Trichoderma species 05FI48 | Mycobacterium bovis | Mycobacterium bovis BCG | MIC = 0.02 μg/ml | In vitro | NA | Tratment with this concentration inhibit 100% bacterial growth | NA | NA | NA | NA | NA | Lipid bilayer | NA | NA | 2010 | 20483615 |
| antitb_1886 | Trichoderins A | PXXXIVXX | Addition of MDA (2-methyl decanoic acid) | Addition of AMAE (2-[(20-aminopropyl) methylamino] ethanol) | Addition of AHMOD at residue 2 (2-amino-6-hydroxy-4-methyl-8-oxodecanoic acid) and AIB (a-aminoisobutyric acid) at 3,4,7, and 8 | Cyclic | 8 | D | NA | Natural | Isolated from Trichoderma species 05FI48 | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37RV | MIC = 0.12 μg/ml | In vitro | NA | Tratment with this concentration inhibit 100% bacterial growth | NA | NA | NA | NA | NA | Lipid bilayer | NA | NA | 2010 | 20483615 |
| antitb_1887 | Trichoderins A1 | PXXXIVXX | Addition of MDA (2-methyl decanoic acid) | Addition of AMAE (2-[(20-aminopropyl) methylamino] ethanol) | Addition of AHMOD at residue 2 (2-amino-6-hydroxy-4-methyl-8-oxodecanoic acid) and AIB (a-aminoisobutyric acid) at 3,4,7, and 8 | Cyclic | 8 | D | NA | Natural | Isolated from Trichoderma species 05FI48 | Mycobacterium smegmatis | Mycobacterium smegmatis M341 | MIC = 1.56 μg/mL | In vitro | NA | Tratment with this concentration inhibit 100% bacterial growth | NA | NA | NA | NA | NA | Lipid bilayer | NA | NA | 2010 | 20483615 |
| antitb_1888 | Trichoderins A | PXXXIVXX | Addition of MDA (2-methyl decanoic acid) | Addition of AMAE (2-[(20-aminopropyl) methylamino] ethanol) | Addition of AHMOD at residue 2 (2-amino-6-hydroxy-4-methyl-8-oxodecanoic acid) and AIB (a-aminoisobutyric acid) at 3,4,7, and 8 | Cyclic | 8 | D | NA | Natural | Isolated from Trichoderma species 05FI48 | Mycobacterium bovis | Mycobacterium bovis BCG | MIC = 0.16 μg/ml | In vitro | NA | Tratment with this concentration inhibit 100% bacterial growth | NA | NA | NA | NA | NA | Lipid bilayer | NA | NA | 2010 | 20483615 |
| antitb_1889 | Trichoderins A1 | PXXXIVXX | Addition of MDA (2-methyl decanoic acid) | Addition of AMAE (2-[(20-aminopropyl) methylamino] ethanol) | Addition of AHMOD at residue 2 (2-amino-6-hydroxy-4-methyl-8-oxodecanoic acid) and AIB (a-aminoisobutyric acid) at 3,4,7, and 8 | Cyclic | 8 | D | NA | Natural | Isolated from Trichoderma species 05FI48 | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37RV | MIC = 2.0 μg/ml | In vitro | NA | Tratment with this concentration inhibit 100% bacterial growth | NA | NA | NA | NA | NA | Lipid bilayer | NA | NA | 2010 | 20483615 |
| antitb_1890 | Trichoderin B | PXXXVVXX | Addition of MDA (2-methyl decanoic acid) | Addition of AMAE (2-[(20-aminopropyl) methylamino] ethanol) | Addition of AHMOD at residue 2 (2-amino-6-hydroxy-4-methyl-8-oxodecanoic acid) and AIB (a-aminoisobutyric acid) at 3,4,7, and 8 | Cyclic | 8 | D | NA | Natural | Isolated from Trichoderma species 05FI48 | Mycobacterium smegmatis | Mycobacterium smegmatis M341 | MIC = 0.63 μg/mL | In vitro | NA | Tratment with this concentration inhibit 100% bacterial growth | NA | NA | NA | NA | NA | Lipid bilayer | NA | NA | 2010 | 20483615 |
| antitb_1891 | Trichoderin B | PXXXVVXX | Addition of MDA (2-methyl decanoic acid) | Addition of AMAE (2-[(20-aminopropyl) methylamino] ethanol) | Addition of AHMOD at residue 2 (2-amino-6-hydroxy-4-methyl-8-oxodecanoic acid) and AIB (a-aminoisobutyric acid) at 3,4,7, and 8 | Cyclic | 8 | D | NA | Natural | Isolated from Trichoderma species 05FI48 | Mycobacterium bovis | Mycobacterium bovis BCG | MIC = 0.02 μg/ml | In vitro | NA | Tratment with this concentration inhibit 100% bacterial growth | NA | NA | NA | NA | NA | Lipid bilayer | NA | NA | 2010 | 20483615 |
| antitb_1892 | Trichoderin B | PXXXVVXX | Addition of MDA (2-methyl decanoic acid) | Addition of AMAE (2-[(20-aminopropyl) methylamino] ethanol) | Addition of AHMOD at residue 2 (2-amino-6-hydroxy-4-methyl-8-oxodecanoic acid) and AIB (a-aminoisobutyric acid) at 3,4,7, and 8 | Cyclic | 8 | D | NA | Natural | Isolated from Trichoderma species 05FI48 | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37RV | MIC = 0.63 μg/ml | In vitro | NA | Tratment with this concentration inhibit 100% bacterial growth | NA | NA | NA | NA | NA | Lipid bilayer | NA | NA | 2010 | 20483615 |
| antitb_1906 | Bovine lactoferricin 17-30 | FKCRRWQWRMKKLG | Free | Free | None | Linear | 14 | D | Cationic | Natural | Derived from bovine lactoferricin protein | Mycobacterium avium | Mycobacterium avium | Mycobacterium avium 2447 smT | In vitro | NA | Tratment with this concentration inhibit 50% bacterial growth | NA | NA | NA | NA | NA | Lipid bilayer | NA | NA | 2014 | 24709266 |
| antitb_1907 | Bovine lactoferricin 17-30 | FKCRRWQWRMKKLG | Free | Free | None | Linear | 14 | D | Cationic | Natural | Derived from bovine lactoferricin protein | Mycobacterium avium | Mycobacterium avium | Mycobacterium avium 2447 smT | In vitro | NA | Tratment with this concentration inhibit 90% bacterial growth | NA | NA | NA | NA | NA | Lipid bilayer | NA | NA | 2014 | 24709266 |
| antitb_1915 | Laterosporulin 10 | ACVNQCPDAIDRFIVKDKGCHGVEKKYYKQVYVACMNGQHLYCRTEWGGPCQL | Free | Free | Disulphide bond between residues 2-43, 6-35 and 20-51 | Cyclic | 53 | D | Cationic | Natural | Derived from Brevibacillus species SKDU10 | Mycobacterium smegmatis | Mycobacterium smegmatis MC2 155 | MIC = 45 μM | In vitro and ex vivo | RAW 264.7 murine macrophage | NA | No cytotoxicity upto 40 μM/ml concentration | NA | NA | NA | NA | Cell wall pore formation | 0.00625 μM of rifampicin with 0.25 μM of peptide, a fourfold reduction in MIC of rifampicin against H37 RV | Antibacterial against Staphylococcus aureus MTCC 1430, Bacillus subtilis MTCC 121, Pseudomonas aeruginosa MTCC 1934, Vibrio cholerae MTCC 3904, Escherichia coli MTCC 1610 | 2016 | 27267959 |
| antitb_1916 | Peptide-1 | GF(A6c)G(A6c)KK(A6c)G(A6c)F(A6c)G(A6c)GKK(A6c)KKKK | Acetylation | Amidation | A6c = 1-aminocyclohexane carboxylic acid, | Linear | 22 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC =4.92 μM | In vitro | NA | NA | NA | NA | NA | NA | NA | Cell wall pore formation | NA | Antibacterial against Enterobacter aerogenes, Acinetobacter baumannii, Psuedomonas aeruginosa, Klebsiella pneumoniae, Eenterococcus faecalis, Staphylococcus aureus | 2016 | 27387357 |
| antitb_1917 | Peptide-2 | GF(A6c)G(A6c)R(A6c)G(A6c)F(A6c)G(A6c)GR(A6c)RRRR | Acetylation | Amidation | A6c = 1-aminocyclohexane carboxylic acid, | Linear | 19 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 40.75 μM | In vitro | NA | NA | NA | NA | NA | NA | NA | Cell wall pore formation | NA | Antibacterial against Enterobacter aerogenes, Acinetobacter baumannii, Psuedomonas aeruginosa, Klebsiella pneumoniae, Eenterococcus faecalis, Staphylococcus aureus | 2016 | 27387357 |
| antitb_1918 | Peptide-3 | GF(A6c)G(A6c)Orn(A6c)G(A6c)F(A6c)G(A6c)GOrn(A6c)Orn-Orn- Orn- Orn | Acetylation | Amidation | A6c = 1-aminocyclohexane carboxylic acid, orn = ornithine | Linear | 20 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 11.37 μM | In vitro | NA | NA | NA | NA | NA | NA | NA | Cell wall pore formation | NA | Antibacterial against Enterobacter aerogenes, Acinetobacter baumannii, Psuedomonas aeruginosa, Klebsiella pneumoniae, Eenterococcus faecalis, Staphylococcus aureus | 2016 | 27387357 |
| antitb_1919 | Peptide-4 | GF(A6c)G(A6c)Dab(A6c)G(A6c)F(A6c)G(A6c)GDab(A6c)Dab-Dab-Dab-Dab | Acetylation | Amidation | A6c = 1-aminocyclohexane carboxylic acid, Dab = 2,4-diaminobutyric acid | Linear | 20 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC =11.83 μM | In vitro | NA | NA | NA | NA | NA | NA | NA | Cell wall pore formation | NA | Antibacterial against Enterobacter aerogenes, Acinetobacter baumannii, Psuedomonas aeruginosa, Klebsiella pneumoniae, Eenterococcus faecalis, Staphylococcus aureus | 2016 | 27387357 |
| antitb_1920 | Peptide-5 | GF(A6c)G(A6c)Dpr(A6c)G(A6c)F(A6c)G(A6c)GDpr(A6c) Dpr-Dpr-Dpr- Dpr | Acetylation | Amidation | A6c = 1-aminocyclohexane carboxylic acid, Dpr = 2,4-diaminopropanoic acid | Linear | 20 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 24.63 μM | In vitro | NA | NA | NA | NA | NA | NA | NA | Cell wall pore formation | NA | Antibacterial against Enterobacter aerogenes, Acinetobacter baumannii, Psuedomonas aeruginosa, Klebsiella pneumoniae, Eenterococcus faecalis, Staphylococcus aureus | 2016 | 27387357 |
| antitb_1921 | Peptide-6 | GF(A5c)G(A5c)K(A5c)G(A5c)F(A5c)G(A5c)GK(A5c)KKKK | Acetylation | Amidation | A5c = 1-aminocyclopentane carboxylic acid | Linear | 20 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 11.42 μM | In vitro | NA | NA | NA | NA | NA | NA | NA | Cell wall pore formation | NA | Antibacterial against Enterobacter aerogenes, Acinetobacter baumannii, Psuedomonas aeruginosa, Klebsiella pneumoniae, Eenterococcus faecalis, Staphylococcus aureus | 2016 | 27387357 |
| antitb_1922 | Peptide-7 | GF(A5c)G(A5c)R(A5c)G(A5c)F(A5c)G(A5c)GR(A5c)RRRR | Acetylation | Amidation | A5c = 1-aminocyclopentane carboxylic acid | Linear | 20 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC =21.22 μM | In vitro | NA | NA | NA | NA | NA | NA | NA | Cell wall pore formation | NA | Antibacterial against Enterobacter aerogenes, Acinetobacter baumannii, Psuedomonas aeruginosa, Klebsiella pneumoniae, Eenterococcus faecalis, Staphylococcus aureus | 2016 | 27387357 |
| antitb_1923 | Peptide-8 | GF(A6c)G(Tic)K(A6c)G(Tic)F(A6c)G(Tic)GK(Tic)KKKK | Acetylation | Amidation | Tic = Tetrahydroisoquinolinecarboxylic acid, A6c 1-aminocyclohexane carboxylic acid | Linear | 20 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 10.33 μM | In vitro | NA | NA | NA | NA | NA | NA | NA | Cell wall pore formation | NA | Antibacterial against Enterobacter aerogenes, Acinetobacter baumannii, Psuedomonas aeruginosa, Klebsiella pneumoniae, Eenterococcus faecalis, Staphylococcus aureus | 2016 | 27387357 |
| antitb_1924 | Peptide-9 | GF(A6c)G(Oic)K(A6c)G(Oic)F(A6c)G(Oic)GK(Oic)KKKK | Acetylation | Amidation | A6c = 1-aminocyclohexane carboxylic acid, Oic = Octahydroindolecarboxylic acid | Linear | 20 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 20.92 μM | In vitro | NA | NA | NA | NA | NA | NA | NA | Cell wall pore formation | NA | Antibacterial against Enterobacter aerogenes, Acinetobacter baumannii, Psuedomonas aeruginosa, Klebsiella pneumoniae, Eenterococcus faecalis, Staphylococcus aureus | 2016 | 27387357 |
| antitb_1925 | Peptide-10 | GF(A5c)G(A6c)K(A5c)G(A6c)F(A5c)G(A6c)GK(A5c)KKKK | Acetylation | Amidation | A5c = 1-aminocyclopentane carboxylic acid, A6c 1-aminocyclohexane carboxylic acid | Linear | 20 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 22.42 μM | In vitro | NA | NA | NA | NA | NA | NA | NA | Cell wall pore formation | NA | Antibacterial against Enterobacter aerogenes, Acinetobacter baumannii, Psuedomonas aeruginosa, Klebsiella pneumoniae, Eenterococcus faecalis, Staphylococcus aureus | 2016 | 27387357 |
| antitb_1926 | Peptide-11 | KKKKGF(A6c)G(A6c)K(A6c)G(A6c)F(A6c)G(A6c)GK(A6c) | Acetylation | Amidation | A6c = 1-aminocyclohexane carboxylic acid, | Linear | 20 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 21.87 μM | In vitro | NA | NA | NA | NA | NA | NA | NA | Cell wall pore formation | NA | Antibacterial against Enterobacter aerogenes, Acinetobacter baumannii, Psuedomonas aeruginosa, Klebsiella pneumoniae, Eenterococcus faecalis, Staphylococcus aureus | 2016 | 27387357 |
| antitb_1927 | Peptide-1 | GF(A6c)G(A6c)KK(A6c)G(A6c)F(A6c)G(A6c)GKK(A6c)KKKK | Acetylation | Amidation | A6c = 1-aminocyclohexane carboxylic acid, | Linear | 22 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis MDR | MIC =4.92 μM | In vitro | NA | NA | NA | NA | NA | NA | NA | Cell wall pore formation | NA | Antibacterial against Enterobacter aerogenes, Acinetobacter baumannii, Psuedomonas aeruginosa, Klebsiella pneumoniae, Eenterococcus faecalis, Staphylococcus aureus | 2016 | 27387357 |
| antitb_1928 | Peptide-2 | GF(A6c)G(A6c)R(A6c)G(A6c)F(A6c)G(A6c)GR(A6c)RRRR | Acetylation | Amidation | A6c = 1-aminocyclohexane carboxylic acid, | Linear | 19 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis MDR | MIC = 40.75 μM | In vitro | NA | NA | NA | NA | NA | NA | NA | Cell wall pore formation | NA | Antibacterial against Enterobacter aerogenes, Acinetobacter baumannii, Psuedomonas aeruginosa, Klebsiella pneumoniae, Eenterococcus faecalis, Staphylococcus aureus | 2016 | 27387357 |
| antitb_1929 | Peptide-3 | GF(A6c)G(A6c)Orn(A6c)G(A6c)F(A6c)G(A6c)GOrn(A6c)Orn-Orn- Orn- Orn | Acetylation | Amidation | A6c = 1-aminocyclohexane carboxylic acid, orn = ornithine | Linear | 20 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis MDR | MIC = 11.37 μM | In vitro | NA | NA | NA | NA | NA | NA | NA | Cell wall pore formation | NA | Antibacterial against Enterobacter aerogenes, Acinetobacter baumannii, Psuedomonas aeruginosa, Klebsiella pneumoniae, Eenterococcus faecalis, Staphylococcus aureus | 2016 | 27387357 |
| antitb_1930 | Peptide-4 | GF(A6c)G(A6c)Dab(A6c)G(A6c)F(A6c)G(A6c)GDab(A6c)Dab-Dab-Dab-Dab | Acetylation | Amidation | A6c = 1-aminocyclohexane carboxylic acid, Dab = 2,4-diaminobutyric acid | Linear | 20 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis MDR | MIC =25.65 μM | In vitro | NA | NA | NA | NA | NA | NA | NA | Cell wall pore formation | NA | Antibacterial against Enterobacter aerogenes, Acinetobacter baumannii, Psuedomonas aeruginosa, Klebsiella pneumoniae, Eenterococcus faecalis, Staphylococcus aureus | 2016 | 27387357 |
| antitb_1931 | Peptide-5 | GF(A6c)G(A6c)Dpr(A6c)G(A6c)F(A6c)G(A6c)GDpr(A6c) Dpr-Dpr-Dpr- Dpr | Acetylation | Amidation | A6c = 1-aminocyclohexane carboxylic acid, Dpr = 2,4-diaminopropanoic acid | Linear | 20 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis MDR | MIC = 49.26 μM | In vitro | NA | NA | NA | NA | NA | NA | NA | Cell wall pore formation | NA | Antibacterial against Enterobacter aerogenes, Acinetobacter baumannii, Psuedomonas aeruginosa, Klebsiella pneumoniae, Eenterococcus faecalis, Staphylococcus aureus | 2016 | 27387357 |
| antitb_1932 | Peptide-6 | GF(A5c)G(A5c)K(A5c)G(A5c)F(A5c)G(A5c)GK(A5c)KKKK | Acetylation | Amidation | A5c = 1-aminocyclopentane carboxylic acid | Linear | 20 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis MDR | MIC = 22.85 μM | In vitro | NA | NA | NA | NA | NA | NA | NA | Cell wall pore formation | NA | Antibacterial against Enterobacter aerogenes, Acinetobacter baumannii, Psuedomonas aeruginosa, Klebsiella pneumoniae, Eenterococcus faecalis, Staphylococcus aureus | 2016 | 27387357 |
| antitb_1933 | Peptide-7 | GF(A5c)G(A5c)R(A5c)G(A5c)F(A5c)G(A5c)GR(A5c)RRRR | Acetylation | Amidation | A5c = 1-aminocyclopentane carboxylic acid | Linear | 20 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis MDR | MIC >43 μM | In vitro | NA | NA | NA | NA | NA | NA | NA | Cell wall pore formation | NA | Antibacterial against Enterobacter aerogenes, Acinetobacter baumannii, Psuedomonas aeruginosa, Klebsiella pneumoniae, Eenterococcus faecalis, Staphylococcus aureus | 2016 | 27387357 |
| antitb_1934 | Peptide-8 | GF(A6c)G(Tic)K(A6c)G(Tic)F(A6c)G(Tic)GK(Tic)KKKK | Acetylation | Amidation | Tic = Tetrahydroisoquinolinecarboxylic acid, A6c 1-aminocyclohexane carboxylic acid | Linear | 20 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis MDR | MIC = 20.6μM | In vitro | NA | NA | NA | NA | NA | NA | NA | Cell wall pore formation | NA | Antibacterial against Enterobacter aerogenes, Acinetobacter baumannii, Psuedomonas aeruginosa, Klebsiella pneumoniae, Eenterococcus faecalis, Staphylococcus aureus | 2016 | 27387357 |
| antitb_1935 | Peptide-9 | GF(A6c)G(Oic)K(A6c)G(Oic)F(A6c)G(Oic)GK(Oic)KKKK | Acetylation | Amidation | A6c = 1-aminocyclohexane carboxylic acid, Oic = Octahydroindolecarboxylic acid | Linear | 20 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis MDR | MIC = 20.92 μM | In vitro | NA | NA | NA | NA | NA | NA | NA | Cell wall pore formation | NA | Antibacterial against Enterobacter aerogenes, Acinetobacter baumannii, Psuedomonas aeruginosa, Klebsiella pneumoniae, Eenterococcus faecalis, Staphylococcus aureus | 2016 | 27387357 |
| antitb_1936 | Peptide-10 | GF(A5c)G(A6c)K(A5c)G(A6c)F(A5c)G(A6c)GK(A5c)KKKK | Acetylation | Amidation | A5c = 1-aminocyclopentane carboxylic acid, A6c 1-aminocyclohexane carboxylic acid | Linear | 20 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis MDR | MIC = 11.21 μM | In vitro | NA | NA | NA | NA | NA | NA | NA | Cell wall pore formation | NA | Antibacterial against Enterobacter aerogenes, Acinetobacter baumannii, Psuedomonas aeruginosa, Klebsiella pneumoniae, Eenterococcus faecalis, Staphylococcus aureus | 2016 | 27387357 |
| antitb_1937 | Peptide-11 | KKKKGF(A6c)G(A6c)K(A6c)G(A6c)F(A6c)G(A6c)GK(A6c) | Acetylation | Amidation | A6c = 1-aminocyclohexane carboxylic acid, | Linear | 20 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis MDR | MIC = 5.47 μM | In vitro | NA | NA | NA | NA | NA | NA | NA | Cell wall pore formation | NA | Antibacterial against Enterobacter aerogenes, Acinetobacter baumannii, Psuedomonas aeruginosa, Klebsiella pneumoniae, Eenterococcus faecalis, Staphylococcus aureus | 2016 | 27387357 |
| antitb_1938 | Peptide-1 | GF(A6c)G(A6c)KK(A6c)G(A6c)F(A6c)G(A6c)GKK(A6c)KKKK | Acetylation | Amidation | A6c = 1-aminocyclohexane carboxylic acid, | Linear | 22 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis XDR | MIC =4.92 μM | In vitro | NA | NA | NA | NA | NA | NA | NA | Cell wall pore formation | NA | Antibacterial against Enterobacter aerogenes, Acinetobacter baumannii, Psuedomonas aeruginosa, Klebsiella pneumoniae, Eenterococcus faecalis, Staphylococcus aureus | 2016 | 27387357 |