Browse result page of AntiTbPdb
The total number entries retrieved from this search are 279
| ID | Name | Sequence | N-Terminal Modification | C-Terminal Modification | Chemical Modification | Linear/Cyclic | Length | Chirality | Nature | Source | Origin | Species | Strain | Inhibition Concentration | In vitro/ In vivo | Cell Line | Intracellular Inhibition | Cytotoxicity | Animal Model | Effective Dose in model organism | Immune Responce | Mechanism of Action | Target | Combination Therapy | Other Activities | Year of Publication | Pubmed ID/ Patent No. |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| antitb_1857 | Hytramycin I | (METH-Ala)-(D-Pip)-L-( D-Allo-ILE)-Pip-(D-Pip) | Free | Free | METH-ALA= Methylated alanine, D-Pip = piperazic acid moieties, D-Allo-ILE= D form of Allo-isoleucine | Cyclic (Intrachain bond between 1-6) | 6 | Mix | NA | Natural | From Streptomyces hygroscopicus strain ECUM 14046 | Mycobacterium tuberculosis | Mycobacterium tuberculosis resistant to cycloserine (rCS, ATCC 35826) | MIC = 7.4 μg/mL | In vitro | None | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial (Escherichia coli (ATCC 25922), Staphylococcus aureus (ATCC 29213), Acinetobacter baumannii (ATCC BAA-747), Enterococcus faecalis (ATCC 29212), and Pseudomonas aeruginosa (ATCC 27853) | 2013 | 24224794 |
| antitb_1858 | Hytramycin I | (METH-Ala)-(D-Pip)-L-( D-Allo-ILE)-Pip-(D-Pip) | Free | Free | METH-ALA= Methylated alanine, D-Pip = piperazic acid moieties, D-Allo-ILE= D form of Allo-isoleucine | Cyclic (Intrachain bond between 1-6) | 6 | Mix | NA | Natural | From Streptomyces hygroscopicus strain ECUM 14046 | Mycobacterium tuberculosis | Mycobacterium tuberculosis resistant to moxifloxacin (rMOX) | MIC = 4.0 μg/mL | In vitro | None | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial (Escherichia coli (ATCC 25922), Staphylococcus aureus (ATCC 29213), Acinetobacter baumannii (ATCC BAA-747), Enterococcus faecalis (ATCC 29212), and Pseudomonas aeruginosa (ATCC 27853) | 2013 | 24224794 |
| antitb_1859 | Hytramycin I | (METH-Ala)-(D-Pip)-L-( D-Allo-ILE)-Pip-(D-Pip) | Free | Free | METH-ALA= Methylated alanine, D-Pip = piperazic acid moieties, D-Allo-ILE= D form of Allo-isoleucine | Cyclic (Intrachain bond between 1-6) | 6 | Mix | NA | Natural | From Streptomyces hygroscopicus strain ECUM 14046 | Mycobacterium tuberculosis | Mycobacterium tuberculosis resistant to capreomycin (rCAP) | MIC = 4.8 μg/mL | In vitro | None | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial (Escherichia coli (ATCC 25922), Staphylococcus aureus (ATCC 29213), Acinetobacter baumannii (ATCC BAA-747), Enterococcus faecalis (ATCC 29212), and Pseudomonas aeruginosa (ATCC 27853) | 2013 | 24224794 |
| antitb_1882 | Propeptin-2 | GYPWWDYRDLFGGHTFI | Involved in Cyclic bond formation between amino acid 1 and 9 | Free | None | Cyclic | 17 | D | NA | Natural | Isolated from Microbispora species SNA-115 | Mycobacterium phlei | Mycobacterium phlei IFO 3158 | 40 μg/disc | In vitro | NA | Treatment of infected Mycobacterium phlei with 40 μg/disc of Propeptin-2 decreased approximately 90% of the bacterial load in zone inhibition assay | NA | NA | NA | NA | NA | NA | None | Antibacterial against silkworm | 2007 | 17827663 |
| antitb_1883 | Propeptin | GYPWWDYRDLFGGHTFISP | Involved in Cyclic bond formation between amino acid 1 and 9 | Free | None | Cyclic | 19 | D | NA | Natural | Isolated from Microbispora species SNA-115 | Mycobacterium smegmatis | Mycobacterium smegmatis M341 | MIC90 = 100 μg/mL | In vivo | NA | Treatment of infected Mycobacterium smegmatis with 100 μg/ml of Propeptin decreased approximately 90% of the bacterial load | NA | Silkworm hemolymph infected with mycobacterium smegmatis at (1.25 × 107 CFU) | 1.25 × 107 CFU | NA | NA | NA | None | None | 2017 | 28446822 |
| antitb_1884 | Trichoderins A | PXXXIVXX | Addition of MDA (2-methyl decanoic acid) | Addition of AMAE (2-[(20-aminopropyl) methylamino] ethanol) | Addition of AHMOD at residue 2 (2-amino-6-hydroxy-4-methyl-8-oxodecanoic acid) and AIB (a-aminoisobutyric acid) at 3,4,7, and 8 | Cyclic | 8 | D | NA | Natural | Isolated from Trichoderma species 05FI48 | Mycobacterium smegmatis | Mycobacterium smegmatis | MIC = 0.1 μg/mL | In vitro | NA | Tratment with this concentration inhibit 100% bacterial growth | NA | NA | NA | NA | NA | Lipid bilayer | NA | NA | 2010 | 20483615 |
| antitb_1885 | Trichoderins A | PXXXIVXX | Addition of MDA (2-methyl decanoic acid) | Addition of AMAE (2-[(20-aminopropyl) methylamino] ethanol) | Addition of AHMOD at residue 2 (2-amino-6-hydroxy-4-methyl-8-oxodecanoic acid) and AIB (a-aminoisobutyric acid) at 3,4,7, and 8 | Cyclic | 8 | D | NA | Natural | Isolated from Trichoderma species 05FI48 | Mycobacterium bovis | Mycobacterium bovis BCG | MIC = 0.02 μg/ml | In vitro | NA | Tratment with this concentration inhibit 100% bacterial growth | NA | NA | NA | NA | NA | Lipid bilayer | NA | NA | 2010 | 20483615 |
| antitb_1886 | Trichoderins A | PXXXIVXX | Addition of MDA (2-methyl decanoic acid) | Addition of AMAE (2-[(20-aminopropyl) methylamino] ethanol) | Addition of AHMOD at residue 2 (2-amino-6-hydroxy-4-methyl-8-oxodecanoic acid) and AIB (a-aminoisobutyric acid) at 3,4,7, and 8 | Cyclic | 8 | D | NA | Natural | Isolated from Trichoderma species 05FI48 | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37RV | MIC = 0.12 μg/ml | In vitro | NA | Tratment with this concentration inhibit 100% bacterial growth | NA | NA | NA | NA | NA | Lipid bilayer | NA | NA | 2010 | 20483615 |
| antitb_1887 | Trichoderins A1 | PXXXIVXX | Addition of MDA (2-methyl decanoic acid) | Addition of AMAE (2-[(20-aminopropyl) methylamino] ethanol) | Addition of AHMOD at residue 2 (2-amino-6-hydroxy-4-methyl-8-oxodecanoic acid) and AIB (a-aminoisobutyric acid) at 3,4,7, and 8 | Cyclic | 8 | D | NA | Natural | Isolated from Trichoderma species 05FI48 | Mycobacterium smegmatis | Mycobacterium smegmatis M341 | MIC = 1.56 μg/mL | In vitro | NA | Tratment with this concentration inhibit 100% bacterial growth | NA | NA | NA | NA | NA | Lipid bilayer | NA | NA | 2010 | 20483615 |
| antitb_1888 | Trichoderins A | PXXXIVXX | Addition of MDA (2-methyl decanoic acid) | Addition of AMAE (2-[(20-aminopropyl) methylamino] ethanol) | Addition of AHMOD at residue 2 (2-amino-6-hydroxy-4-methyl-8-oxodecanoic acid) and AIB (a-aminoisobutyric acid) at 3,4,7, and 8 | Cyclic | 8 | D | NA | Natural | Isolated from Trichoderma species 05FI48 | Mycobacterium bovis | Mycobacterium bovis BCG | MIC = 0.16 μg/ml | In vitro | NA | Tratment with this concentration inhibit 100% bacterial growth | NA | NA | NA | NA | NA | Lipid bilayer | NA | NA | 2010 | 20483615 |
| antitb_1889 | Trichoderins A1 | PXXXIVXX | Addition of MDA (2-methyl decanoic acid) | Addition of AMAE (2-[(20-aminopropyl) methylamino] ethanol) | Addition of AHMOD at residue 2 (2-amino-6-hydroxy-4-methyl-8-oxodecanoic acid) and AIB (a-aminoisobutyric acid) at 3,4,7, and 8 | Cyclic | 8 | D | NA | Natural | Isolated from Trichoderma species 05FI48 | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37RV | MIC = 2.0 μg/ml | In vitro | NA | Tratment with this concentration inhibit 100% bacterial growth | NA | NA | NA | NA | NA | Lipid bilayer | NA | NA | 2010 | 20483615 |
| antitb_1890 | Trichoderin B | PXXXVVXX | Addition of MDA (2-methyl decanoic acid) | Addition of AMAE (2-[(20-aminopropyl) methylamino] ethanol) | Addition of AHMOD at residue 2 (2-amino-6-hydroxy-4-methyl-8-oxodecanoic acid) and AIB (a-aminoisobutyric acid) at 3,4,7, and 8 | Cyclic | 8 | D | NA | Natural | Isolated from Trichoderma species 05FI48 | Mycobacterium smegmatis | Mycobacterium smegmatis M341 | MIC = 0.63 μg/mL | In vitro | NA | Tratment with this concentration inhibit 100% bacterial growth | NA | NA | NA | NA | NA | Lipid bilayer | NA | NA | 2010 | 20483615 |
| antitb_1891 | Trichoderin B | PXXXVVXX | Addition of MDA (2-methyl decanoic acid) | Addition of AMAE (2-[(20-aminopropyl) methylamino] ethanol) | Addition of AHMOD at residue 2 (2-amino-6-hydroxy-4-methyl-8-oxodecanoic acid) and AIB (a-aminoisobutyric acid) at 3,4,7, and 8 | Cyclic | 8 | D | NA | Natural | Isolated from Trichoderma species 05FI48 | Mycobacterium bovis | Mycobacterium bovis BCG | MIC = 0.02 μg/ml | In vitro | NA | Tratment with this concentration inhibit 100% bacterial growth | NA | NA | NA | NA | NA | Lipid bilayer | NA | NA | 2010 | 20483615 |
| antitb_1892 | Trichoderin B | PXXXVVXX | Addition of MDA (2-methyl decanoic acid) | Addition of AMAE (2-[(20-aminopropyl) methylamino] ethanol) | Addition of AHMOD at residue 2 (2-amino-6-hydroxy-4-methyl-8-oxodecanoic acid) and AIB (a-aminoisobutyric acid) at 3,4,7, and 8 | Cyclic | 8 | D | NA | Natural | Isolated from Trichoderma species 05FI48 | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37RV | MIC = 0.63 μg/ml | In vitro | NA | Tratment with this concentration inhibit 100% bacterial growth | NA | NA | NA | NA | NA | Lipid bilayer | NA | NA | 2010 | 20483615 |
| antitb_1915 | Laterosporulin 10 | ACVNQCPDAIDRFIVKDKGCHGVEKKYYKQVYVACMNGQHLYCRTEWGGPCQL | Free | Free | Disulphide bond between residues 2-43, 6-35 and 20-51 | Cyclic | 53 | D | Cationic | Natural | Derived from Brevibacillus species SKDU10 | Mycobacterium smegmatis | Mycobacterium smegmatis MC2 155 | MIC = 45 μM | In vitro and ex vivo | RAW 264.7 murine macrophage | NA | No cytotoxicity upto 40 μM/ml concentration | NA | NA | NA | NA | Cell wall pore formation | 0.00625 μM of rifampicin with 0.25 μM of peptide, a fourfold reduction in MIC of rifampicin against H37 RV | Antibacterial against Staphylococcus aureus MTCC 1430, Bacillus subtilis MTCC 121, Pseudomonas aeruginosa MTCC 1934, Vibrio cholerae MTCC 3904, Escherichia coli MTCC 1610 | 2016 | 27267959 |
| antitb_1953 | Wollamide- B | WAlVNx | Free | Free | Third residue is D-leucine and x= ornithine | Cyclic | 6 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC > 80 μM | In vitro | HepG2 cell line | NA | Cytoxic above > 100 μM | NA | NA | NA | NA | cell wall pore formation | NA | NA | 2017 | 28423019 |
| antitb_1954 | Wollamide- B | ALlVNx | Free | Free | Third residue is D-leucine and x= ornithine | Cyclic | 6 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC > 80 μM | In vitro | HepG2 cell line | NA | Cytoxic above > 100 μM | NA | NA | NA | NA | cell wall pore formation | NA | NA | 2017 | 28423019 |
| antitb_1955 | Wollamide- B | WLlVAx | Free | Free | Third residue is D-leucine and x= ornithine | Cyclic | 6 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC > 20 μM | In vitro | HepG2 cell line | NA | Cytoxic above > 100 μM | NA | NA | NA | NA | cell wall pore formation | NA | NA | 2017 | 28423019 |
| antitb_1956 | Wollamide- B | WLlANx | Free | Free | Third residue is D-leucine and x= ornithine | Cyclic | 6 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC > 80 μM | In vitro | HepG2 cell line | NA | Cytoxic above > 100 μM | NA | NA | NA | NA | cell wall pore formation | NA | NA | 2017 | 28423019 |
| antitb_1957 | Wollamide- B | WLaVNx | Free | Free | Third residue is D-alanine and x= ornithine | Cyclic | 6 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC > 80 μM | In vitro | HepG2 cell line | NA | Cytoxic above > 100 μM | NA | NA | NA | NA | cell wall pore formation | NA | NA | 2017 | 28423019 |
| antitb_1958 | Wollamide- B | WLlINx | Free | Free | Third residue is D-leucine and x= ornithine | Cyclic | 6 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 1.1 μM | In vitro | HepG2 cell line | NA | Cytoxic above > 50 μM | NA | NA | NA | NA | cell wall pore formation | NA | NA | 2017 | 28423019 |
| antitb_1959 | Wollamide- B | WLlMNx | Free | Free | Third residue is D-leucine and x= ornithine | Cyclic | 6 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC > 80 μM | In vitro | NA | NA | NA | NA | NA | NA | NA | cell wall pore formation | NA | NA | 2017 | 28423019 |
| antitb_1960 | Wollamide- B | WLlVxx | Free | Free | Third residue is D-leucine and x= ornithine | Cyclic | 6 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC =2.5 μM | In vitro | HepG2 cell line | NA | Cytoxic above > 50 μM | NA | NA | NA | NA | cell wall pore formation | NA | NA | 2017 | 28423019 |
| antitb_1961 | Wollamide- B | WLlISx | Free | Free | Third residue is D-leucine and x= ornithine | Cyclic | 6 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC =15 μM | In vitro | HepG2 cell line | NA | Cytoxic above > 100 μM | NA | NA | NA | NA | cell wall pore formation | NA | NA | 2017 | 28423019 |
| antitb_1962 | Wollamide- B | WLlIXx | Free | Free | Third residue is D-leucine, fifth residue is tertiary butyl serine and x= ornithine | Cyclic | 6 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 40 μM | In vitro | HepG2 cell line | NA | Cytoxic above > 100 μM | NA | NA | NA | NA | cell wall pore formation | NA | NA | 2017 | 28423019 |
| antitb_1963 | Wollamide- B | WLlIIx | Free | Free | Third residue is D-leucine and x= ornithine | Cyclic | 6 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 3.1 μM | In vitro | HepG2 cell line | NA | Cytoxic above > 100 μM | NA | NA | NA | NA | cell wall pore formation | NA | NA | 2017 | 28423019 |
| antitb_1964 | Wollamide- B | WLlINr | Free | Free | Third residue is D-leucine and r= D- arginine | Cyclic | 6 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 0.6 μM | In vitro | NA | NA | NA | NA | NA | NA | NA | cell wall pore formation | NA | NA | 2017 | 28423019 |
| antitb_1965 | Wollamide- B | xLlVNx | Free | Free | First residue is D- phenyalanine, Third is D-leucine and sixth is D-ornithine | Cyclic | 6 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 40 μM | In vitro | HepG2 cell line | NA | Cytoxic above > 100 μM | NA | NA | NA | NA | cell wall pore formation | NA | NA | 2017 | 28423019 |
| antitb_1988 | Teixobactin | FISQIISTAI | Free | Free | adenylation, C, condensation; MT, methylation (of phenylalanine); T, thiolation (carrier); and TE,thioesterase (Ile-Thr ring closure). NmPhe,N-methylated phenylalanin | Cyclic | 10 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC= 0.125µg/ml | In vitro | NA | NA | NA | NA | NA | NA | Binding of teixobactin to WTA precursor contributes to efficient lysis and killing, due to digestion of the cell wall by liberated autolysins | Cell wall | NA | S. aureus (MSSA), S. aureus 110% serum, S. aureus (MRSA), Enterococcus faecalis (VRE), Enterococcus faecium (VRE), Streptococcus pneumoniae (penicillinR), Streptococcus pyogenes, Streptococcus agalactiae, Viridans group streptococci, B. anthracis, Clostridium difficile, Propionibacterium acnes, Haemophilus influenzae, Moraxella catarrhalis, Escherichia coli, Escherichia coli (asmB1), Pseudomonas aeruginosa, Klebsiella pneumoniae | 2015 | 25561178 |