The total number entries retrieved from this search are 279

ID	Name	Sequence	N-Terminal Modification	C-Terminal Modification	Chemical Modification	Linear/Cyclic	Length	Chirality	Nature	Source	Origin	Species	Strain	Inhibition Concentration	In vitro/ In vivo	Cell Line	Intracellular Inhibition	Cytotoxicity	Animal Model	Effective Dose in model organism	Immune Responce	Mechanism of Action	Target	Combination Therapy	Other Activities	Year of Publication	Pubmed ID/ Patent No.
antitb_1204	Lassomycin	GLRRLFADQLVGRRNI-CO2CH3	Involved in Cyclic formation	Addition of Methyl ester	Formation of an amide bond between N-terminal amine and the side chain carboxyl group of Asp8.	Cyclic	16	L	Highly Basic	Natural	Extracts from soil actinomycetes	Mycobacterium tuberculosis	Mycobacterium tuberculosis resistant to INH, STR (84)	MIC = 1.56-3.1 μg/ml or 0.83 μM	In vitro	Human NIH 3T3 and HepG2, erythrocytes	NA	Low cytotoxicty (IC50, 350 μg/ml) against human NIH 3T3 and HepG2 cells	None	NA	NA	Uncoupling ATPase from proteolytic activity	ClpC1 ATPase complex	None	Antibacterial (other actinobacteria, gram positive and gram negative bacteria)	2014	24684906
antitb_1205	Lassomycin	GLRRLFADQLVGRRNI-CO2CH3	Involved in Cyclic formation	Addition of Methyl ester	Formation of an amide bond between N-terminal amine and the side chain carboxyl group of Asp8.	Cyclic	16	L	Highly Basic	Natural	Extracts from soil actinomycetes	Mycobacterium tuberculosis	Mycobacterium tuberculosis resistant to INH, RIF (85)	MIC = 1.56-3.1 μg/ml or 0.83 μM	In vitro	Human NIH 3T3 and HepG2, erythrocytes	NA	Low cytotoxicty (IC50, 350 μg/ml) against human NIH 3T3 and HepG2 cells	None	NA	NA	Uncoupling ATPase from proteolytic activity	ClpC1 ATPase complex	None	Antibacterial (other actinobacteria, gram positive and gram negative bacteria)	2014	24684906
antitb_1206	Lassomycin	GLRRLFADQLVGRRNI-CO2CH3	Involved in Cyclic formation	Addition of Methyl ester	Formation of an amide bond between N-terminal amine and the side chain carboxyl group of Asp8.	Cyclic	16	L	Highly Basic	Natural	Extracts from soil actinomycetes	Mycobacterium tuberculosis	Mycobacterium tuberculosis resistant to INH, RIF (7)	MIC = 1.56 μg/ml or 0.83 μM	In vitro	Human NIH 3T3 and HepG2, erythrocytes	NA	Low cytotoxicty (IC50, 350 μg/ml) against human NIH 3T3 and HepG2 cells	None	NA	NA	Uncoupling ATPase from proteolytic activity	ClpC1 ATPase complex	None	Antibacterial (other actinobacteria, gram positive and gram negative bacteria)	2014	24684906
antitb_1207	Lassomycin	GLRRLFADQLVGRRNI-CO2CH3	Involved in Cyclic formation	Addition of Methyl ester	Formation of an amide bond between N-terminal amine and the side chain carboxyl group of Asp8.	Cyclic	16	L	Highly Basic	Natural	Extracts from soil actinomycetes	Mycobacterium tuberculosis	Mycobacterium tuberculosis resistant to INH, RIF, STR (86)	MIC = 1.56 μg/ml or 0.83 μM	In vitro	Human NIH 3T3 and HepG2, erythrocytes	NA	Low cytotoxicty (IC50, 350 μg/ml) against human NIH 3T3 and HepG2 cells	None	NA	NA	Uncoupling ATPase from proteolytic activity	ClpC1 ATPase complex	None	Antibacterial (other actinobacteria, gram positive and gram negative bacteria)	2014	24684906
antitb_1208	Lassomycin	GLRRLFADQLVGRRNI-CO2CH3	Involved in Cyclic formation	Addition of Methyl ester	Formation of an amide bond between N-terminal amine and the side chain carboxyl group of Asp8.	Cyclic	16	L	Highly Basic	Natural	Extracts from soil actinomycetes	Mycobacterium tuberculosis	Mycobacterium tuberculosis resistant to INH, RIF, STR, FQ (136)	MIC = 0.78 μg/ml or 0.41 μM	In vitro	Human NIH 3T3 and HepG2, erythrocytes	NA	Low cytotoxicty (IC50, 350 μg/ml) against human NIH 3T3 and HepG2 cells	None	NA	NA	Uncoupling ATPase from proteolytic activity	ClpC1 ATPase complex	None	Antibacterial (other actinobacteria, gram positive and gram negative bacteria)	2014	24684906
antitb_1209	Lassomycin	GLRRLFADQLVGRRNI-CO2CH3	Involved in Cyclic formation	Addition of Methyl ester	Formation of an amide bond between N-terminal amine and the side chain carboxyl group of Asp8.	Cyclic	16	L	Highly Basic	Natural	Extracts from soil actinomycetes	Mycobacterium tuberculosis	Mycobacterium tuberculosis resistant to INH, RIF, STR, FQ (133)	MIC = 0.78 μg/ml or 0.41 μM	In vitro	Human NIH 3T3 and HepG2, erythrocytes	NA	Low cytotoxicty (IC50, 350 μg/ml) against human NIH 3T3 and HepG2 cells	None	NA	NA	Uncoupling ATPase from proteolytic activity	ClpC1 ATPase complex	None	Antibacterial (other actinobacteria, gram positive and gram negative bacteria)	2014	24684906
antitb_1210	Lassomycin	GLRRLFADQLVGRRNI-CO2CH3	Involved in Cyclic formation	Addition of Methyl ester	Formation of an amide bond between N-terminal amine and the side chain carboxyl group of Asp8.	Cyclic	16	L	Highly Basic	Natural	Extracts from soil actinomycetes	Mycobacterium tuberculosis	Mycobacterium tuberculosis resistant to INH, RIF, STR, FQ (189)	MIC = 3.1 μg/ml or 1.65 μM	In vitro	Human NIH 3T3 and HepG2, erythrocytes	NA	Low cytotoxicty (IC50, 350 μg/ml) against human NIH 3T3 and HepG2 cells	None	NA	NA	Uncoupling ATPase from proteolytic activity	ClpC1 ATPase complex	None	Antibacterial (other actinobacteria, gram positive and gram negative bacteria)	2014	24684906
antitb_1211	Lassomycin	GLRRLFADQLVGRRNI-CO2CH3	Involved in Cyclic formation	Addition of Methyl ester	Formation of an amide bond between N-terminal amine and the side chain carboxyl group of Asp8.	Cyclic	16	L	Highly Basic	Natural	Extracts from soil actinomycetes	Mycobacterium tuberculosis	Mycobacterium tuberculosis resistant to INH, RIF, EMB, FQ (3)	MIC = 3.1 μg/ml or 1.65 μM	In vitro	Human NIH 3T3 and HepG2, erythrocytes	NA	Low cytotoxicty (IC50, 350 μg/ml) against human NIH 3T3 and HepG2 cells	None	NA	NA	Uncoupling ATPase from proteolytic activity	ClpC1 ATPase complex	None	Antibacterial (other actinobacteria, gram positive and gram negative bacteria)	2014	24684906
antitb_1212	Lassomycin	GLRRLFADQLVGRRNI-CO2CH3	Involved in Cyclic formation	Addition of Methyl ester	Formation of an amide bond between N-terminal amine and the side chain carboxyl group of Asp8.	Cyclic	16	L	Highly Basic	Natural	Extracts from soil actinomycetes	Mycobacterium tuberculosis	Mycobacterium tuberculosis resistant to INH, RIF, EMB, PZA, FQ (30)	MIC = 0.78 μg/ml or 0.41 μM	In vitro	Human NIH 3T3 and HepG2, erythrocytes	NA	Low cytotoxicty (IC50, 350 μg/ml) against human NIH 3T3 and HepG2 cells	None	NA	NA	Uncoupling ATPase from proteolytic activity	ClpC1 ATPase complex	None	Antibacterial (other actinobacteria, gram positive and gram negative bacteria)	2014	24684906
antitb_1213	Lassomycin	GLRRLFADQLVGRRNI-CO2CH3	Involved in Cyclic formation	Addition of Methyl ester	Formation of an amide bond between N-terminal amine and the side chain carboxyl group of Asp8.	Cyclic	16	L	Highly Basic	Natural	Extracts from soil actinomycetes	Mycobacterium tuberculosis	Mycobacterium tuberculosis resistant to INH, RIF, EMB, PZA, FQ (181)	MIC = 0.78 μg/ml or 0.41 μM	In vitro	Human NIH 3T3 and HepG2, erythrocytes	NA	Low cytotoxicty (IC50, 350 μg/ml) against human NIH 3T3 and HepG2 cells	None	NA	NA	Uncoupling ATPase from proteolytic activity	ClpC1 ATPase complex	None	Antibacterial (other actinobacteria, gram positive and gram negative bacteria)	2014	24684906
antitb_1214	Lassomycin	GLRRLFADQLVGRRNI-CO2CH3	Involved in Cyclic formation	Addition of Methyl ester	Formation of an amide bond between N-terminal amine and the side chain carboxyl group of Asp8.	Cyclic	16	L	Highly Basic	Natural	Extracts from soil actinomycetes	Mycobacterium tuberculosis	Mycobacterium tuberculosis resistant to INH, RIF, STR, EMB, PZA, FQ (183)	MIC = 3.1 μg/ml or 1.65 μM	In vitro	Human NIH 3T3 and HepG2, erythrocytes	NA	Low cytotoxicty (IC50, 350 μg/ml) against human NIH 3T3 and HepG2 cells	None	NA	NA	Uncoupling ATPase from proteolytic activity	ClpC1 ATPase complex	None	Antibacterial (other actinobacteria, gram positive and gram negative bacteria)	2014	24684906
antitb_1215	Lassomycin	GLRRLFADQLVGRRNI-CO2CH3	Involved in Cyclic formation	Addition of Methyl ester	Formation of an amide bond between N-terminal amine and the side chain carboxyl group of Asp8.	Cyclic	16	L	Highly Basic	Natural	Extracts from soil actinomycetes	Mycobacterium tuberculosis	Mycobacterium tuberculosis resistant to INH, RIF, STR, EMB, PZA, FQ (188)	MIC = 3.1 μg/ml or 1.65 μM	In vitro	Human NIH 3T3 and HepG2, erythrocytes	NA	Low cytotoxicty (IC50, 350 μg/ml) against human NIH 3T3 and HepG2 cells	None	NA	NA	Uncoupling ATPase from proteolytic activity	ClpC1 ATPase complex	None	Antibacterial (other actinobacteria, gram positive and gram negative bacteria)	2014	24684906
antitb_1216	Lassomycin	GLRRLFADQLVGRRNI-CO2CH3	Involved in Cyclic formation	Addition of Methyl ester	Formation of an amide bond between N-terminal amine and the side chain carboxyl group of Asp8.	Cyclic	16	L	Highly Basic	Natural	Extracts from soil actinomycetes	Mycobacterium tuberculosis	Mycobacterium tuberculosis mc26020	MIC = 0.39-0.78 μg/ml or 0.21-0.41 μM	In vitro	Human NIH 3T3 and HepG2, erythrocytes	NA	Low cytotoxicty (IC50, 350 μg/ml) against human NIH 3T3 and HepG2 cells	None	NA	NA	Uncoupling ATPase from proteolytic activity	ClpC1 ATPase complex	None	Antibacterial (other actinobacteria, gram positive and gram negative bacteria)	2014	24684906
antitb_1217	Lassomycin	GLRRLFADQLVGRRNI-CO2CH3	Involved in Cyclic formation	Addition of Methyl ester	Formation of an amide bond between N-terminal amine and the side chain carboxyl group of Asp8.	Cyclic	16	L	Highly Basic	Natural	Extracts from soil actinomycetes	Mycobacterium avium	Mycobacterium avium subsp. Paratuberculosis	MIC = 0.125-0.25 μg/ml or 0.07-0.13 μM	In vitro	Human NIH 3T3 and HepG2, erythrocytes	NA	Low cytotoxicty (IC50, 350 μg/ml) against human NIH 3T3 and HepG2 cells	None	NA	NA	Uncoupling ATPase from proteolytic activity	ClpC1 ATPase complex	None	Antibacterial (other actinobacteria, gram positive and gram negative bacteria)	2014	24684906
antitb_1218	Lassomycin	GLRRLFADQLVGRRNI-CO2CH3	Involved in Cyclic formation	Addition of Methyl ester	Formation of an amide bond between N-terminal amine and the side chain carboxyl group of Asp8.	Cyclic	16	L	Highly Basic	Natural	Extracts from soil actinomycetes	Mycobacterium smegmatis	Mycobacterium smegmatis	MIC = 0.78-2 μg/ml or 0.41-1.06 μM	In vitro	Human NIH 3T3 and HepG2, erythrocytes	NA	Low cytotoxicty (IC50, 350 μg/ml) against human NIH 3T3 and HepG2 cells	None	NA	NA	Uncoupling ATPase from proteolytic activity	ClpC1 ATPase complex	None	Antibacterial (other actinobacteria, gram positive and gram negative bacteria)	2014	24684906
antitb_1223	Human neutrophil peptide 1 (HNP-1)	ACYCRIPACIAGERRYGTCIYQGRLWAFCC	Free	Free	Disulfide bridge: 2-30, 4-19, 9-29	Cyclic	30	L	NA	Protein Derived	Human neutrophil	Mycobacterium tuberculosis	Mycobacterium tuberculosis H37Rv	96.5 % inhibition at 10 μg/ml	In vitro	THP-1 cells	Significant reduction in CFU	NA	None	NA	NA	NA	NA	None	None	2013	23827033
antitb_1224	Human neutrophil peptide 1 (HNP-1)	ACYCRIPACIAGERRYGTCIYQGRLWAFCC	Free	Free	Disulfide bridge: 2-30, 4-19, 9-30	Cyclic	30	L	NA	Protein Derived	Human neutrophil	Mycobacterium tuberculosis	Mycobacterium tuberculosis H37Rv	98.3 % inhibition at 15 μg/ml	In vitro	THP-1 cells	Significant reduction in CFU	NA	None	NA	NA	NA	NA	None	None	2013	23827033
antitb_1225	Human neutrophil peptide 1 (HNP-1)	ACYCRIPACIAGERRYGTCIYQGRLWAFCC	Free	Free	Disulfide bridge: 2-30, 4-19, 9-31	Cyclic	30	L	NA	Protein Derived	Human neutrophil	Mycobacterium tuberculosis	36 Clinical isolates of Mycobacterium tuberculosis	11 isolates (31%) showed greater sensitivity to HNP-1 than H37Rv strains. At 15 μg/ml, they wer completely inhibited.	In vitro	THP-1 cells	Sixteen clinical isolates had lower intracellular growth ability than the H37Rv strain.	NA	None	NA	NA	NA	NA	None	None	2013	23827033
antitb_1226	Human neutrophil peptide 1 (HNP-1)	ACYCRIPACIAGERRYGTCIYQGRLWAFCC	Free	Free	Disulfide bridge: 2-30, 4-19, 9-32	Cyclic	30	L	NA	Protein Derived	Human neutrophil	Mycobacterium bovis	Mycobacterium bovis BCG	99.6 % inhibition at 10 μg/ml	In vitro	THP-1 cells	Significant reduction in CFU	NA	None	NA	NA	NA	NA	None	None	2013	23827033
antitb_1227	Human neutrophil peptide 1 (HNP-1)	ACYCRIPACIAGERRYGTCIYQGRLWAFCC	Free	Free	Disulfide bridge: 2-30, 4-19, 9-33	Cyclic	30	L	NA	Protein Derived	Human neutrophil	Mycobacterium bovis	Mycobacterium bovis BCG	100 % inhibition at 10 μg/ml	In vitro	THP-1 cells	Significant reduction in CFU	NA	None	NA	NA	NA	NA	None	None	2013	23827033
antitb_1256	Eosinophil Cationic Protein (RNase 3)	RPPQFTRAQWFAIQHISLNPPRCTIAMRAINNYRWRCKNQNTFLRTTFANVVNVCGNQSIRCPHNRTLNN	Free	Free	Disulphide linkage	Cyclic	70	L	Cationic	Natural	Secreted by eosinophil secondary granules	Mycobacterium vaccae	Mycobacterium vaccae strain (ATCC 15483)	MIC = 20.0 ± 1.0 μM	In vitro	None	NA	NA	None	NA	NA	Membrane depolarization and permeabilization	Cell envelope	None	Antibacterial and Antiparasitic	2013	23716047
antitb_1257	Eosinophil Cationic Protein (RNase 3)	RPPQFTRAQWFAIQHISLNPPRCTIAMRAINNYRWRCKNQNTFLRTTFANVVNVCGNQSIRCPHNRTLNN	Free	Free	Disulphide linkage	Cyclic	70	L	Cationic	Natural	Secreted by eosinophil secondary granules	Mycobacterium vaccae	Mycobacterium vaccae strain (ATCC 15483)	IC50 = 11.6 ± 0.2 μM	In vitro	None	NA	NA	None	NA	NA	Membrane depolarization and permeabilization	Cell envelope	None	Antibacterial and Antiparasitic	2013	23716047
antitb_1258	RNase 7	KPKGMTSSQWFKIQHMOPSPQACNSAMKNINKHTKRCKDLNTFLHEPFSSVAATCQTPKIACKNGDKN	Free	Free	Disulphide linkage	Cyclic	68	L	Cationic	Natural	Secreted by innate cells during host defense	Mycobacterium vaccae	Mycobacterium vaccae strain (ATCC 15483)	MIC = 20.0 ± 0.5 μM	In vitro	None	NA	NA	None	NA	NA	Membrane depolarization and permeabilization	Cell envelope	None	Antibacterial and Antiparasitic	2013	23716047
antitb_1259	RNase 7	KPKGMTSSQWFKIQHMOPSPQACNSAMKNINKHTKRCKDLNTFLHEPFSSVAATCQTPKIACKNGDKN	Free	Free	Disulphide linkage	Cyclic	68	L	Cationic	Natural	Secreted by innate cells during host defense	Mycobacterium vaccae	Mycobacterium vaccae strain (ATCC 15483)	IC50 = 9.3 ± 1.2 μM	In vitro	None	NA	NA	None	NA	NA	Membrane depolarization and permeabilization	Cell envelope	None	Antibacterial and Antiparasitic	2013	23716047
antitb_1334	Cairomycin B	not available	NA	NA	NA	Cyclic	0	Mix	NA	Natural	Streptomyces fungus	Mycobacterium tuberculosis	Mycobacterium tuberculosis H37Rv	MIC= 50 μg/mL	Both	NA	NA	NA	Swiss mice	3 mg/kg of body weight	NA	NA	NA	NA	Antimicrobial against S.aureus, B.subtilis, P.aureginosa,Pseudomonas. Antifungal also.	1976	855995
antitb_1335	Dihydromycoplanecin A	R-N(CH3)-CH(CH-CH3-CH3)-CO-N(CH-C-CH2-CH3-C-CH)-CO-N(CH3)-CH-C)-NH-CH(CH2-CH-CH3-CH3)-CO-N-CH-C-CH3_C-CH)-CONH-CH(CH2-CH2-CH-CH3-CH3)-Co-N-CH3-Ch-CH(CH3-CH3)-Co-N-(CH-C-Ch)-Co-N(CH3)-CH(CH2-CH-CH3-CH3)-CO-NH-CH2-CO-O-CH(CH3)	Propanol is attached	Free	R =CH3-CH2-CH(OH)-CO	Cyclic	21	Mix	NA	Natural	Aspergillus awajinensis	Mycobacterium tuberculosis	Mycobacterium tuberculosis H37Rv	IC50 = <0.0125 μg/mL (50%)	Both	NA	NA	NA	ICR/JCL male mice and male beagle dogs	10 mg/kg for mice and 50mg/kg for dog	NA	NA	NA	NA	NA	1988	3348603
antitb_1336	Dihydromycoplanecin A	R-N(CH3)-CH(CH-CH3-CH3)-CO-N(CH-C-CH2-CH3-C-CH)-CO-N(CH3)-CH-C)-NH-CH(CH2-CH-CH3-CH3)-CO-N-CH-C-CH3_C-CH)-CONH-CH(CH2-CH2-CH-CH3-CH3)-Co-N-CH3-Ch-CH(CH3-CH3)-Co-N-(CH-C-Ch)-Co-N(CH3)-CH(CH2-CH-CH3-CH3)-CO-NH-CH2-CO-O-CH(CH3)	Propanol is attached	Free	R =CH3-CH2-CH(OH)-CO	Cyclic	21	Mix	NA	Natural	Aspergillus awajinensis	Mycobacterium intracellulare	Mycobacterium intracellulare	IC50 = 1.56 μg/mL (50%)	Both	NA	NA	NA	ICR/JCL male mice and male beagle dogs	11 mg/kg for mice and 50mg/kg for dog	NA	NA	NA	NA	NA	1988	3348603
antitb_1337	Dihydromycoplanecin A	R-N(CH3)-CH(CH-CH3-CH3)-CO-N(CH-C-CH2-CH3-C-CH)-CO-N(CH3)-CH-C)-NH-CH(CH2-CH-CH3-CH3)-CO-N-CH-C-CH3_C-CH)-CONH-CH(CH2-CH2-CH-CH3-CH3)-Co-N-CH3-Ch-CH(CH3-CH3)-Co-N-(CH-C-Ch)-Co-N(CH3)-CH(CH2-CH-CH3-CH3)-CO-NH-CH2-CO-O-CH(CH3)	Propanol is attached	Free	R =CH3-CH2-CH(OH)-CO	Cyclic	21	Mix	NA	Natural	Aspergillus awajinensis	Mycobacterium kansasii	Mycobacterium kansasii	IC50= 0.39 μg/mL (50%)	Both	NA	NA	NA	ICR/JCL male mice and male beagle dogs	12 mg/kg for mice and 50mg/kg for dog	NA	NA	NA	NA	NA	1988	3348603
antitb_1338	Dihydromycoplanecin A	R-N(CH3)-CH(CH-CH3-CH3)-CO-N(CH-C-CH2-CH3-C-CH)-CO-N(CH3)-CH-C)-NH-CH(CH2-CH-CH3-CH3)-CO-N-CH-C-CH3_C-CH)-CONH-CH(CH2-CH2-CH-CH3-CH3)-Co-N-CH3-Ch-CH(CH3-CH3)-Co-N-(CH-C-Ch)-Co-N(CH3)-CH(CH2-CH-CH3-CH3)-CO-NH-CH2-CO-O-CH(CH3)	Propanol is attached	Free	R =CH3-CH2-CH(OH)-CO	Cyclic	21	Mix	NA	Natural	Aspergillus awajinensis	Mycobacterium tuberculosis	Mycobacterium tuberculosis H37Rv	IC90= 0.05 μg/mL(90%)	Both	NA	NA	NA	ICR/JCL male mice and male beagle dogs	13 mg/kg for mice and 50mg/kg for dog	NA	NA	NA	NA	NA	1988	3348603
antitb_1339	Dihydromycoplanecin A	R-N(CH3)-CH(CH-CH3-CH3)-CO-N(CH-C-CH2-CH3-C-CH)-CO-N(CH3)-CH-C)-NH-CH(CH2-CH-CH3-CH3)-CO-N-CH-C-CH3_C-CH)-CONH-CH(CH2-CH2-CH-CH3-CH3)-Co-N-CH3-Ch-CH(CH3-CH3)-Co-N-(CH-C-Ch)-Co-N(CH3)-CH(CH2-CH-CH3-CH3)-CO-NH-CH2-CO-O-CH(CH3)	Propanol is attached	Free	R =CH3-CH2-CH(OH)-CO	Cyclic	21	Mix	NA	Natural	Aspergillus awajinensis	Mycobacterium intracellulare	Mycobacterium intracellulare	IC90= 0.78 μg/mL(90%)	Both	NA	NA	NA	ICR/JCL male mice and male beagle dogs	14 mg/kg for mice and 50mg/kg for dog	NA	NA	NA	NA	NA	1988	3348603
antitb_1340	Dihydromycoplanecin A	R-N(CH3)-CH(CH-CH3-CH3)-CO-N(CH-C-CH2-CH3-C-CH)-CO-N(CH3)-CH-C)-NH-CH(CH2-CH-CH3-CH3)-CO-N-CH-C-CH3_C-CH)-CONH-CH(CH2-CH2-CH-CH3-CH3)-Co-N-CH3-Ch-CH(CH3-CH3)-Co-N-(CH-C-Ch)-Co-N(CH3)-CH(CH2-CH-CH3-CH3)-CO-NH-CH2-CO-O-CH(CH3)	Propanol is attached	Free	R =CH3-CH2-CH(OH)-CO	Cyclic	21	Mix	NA	Natural	Aspergillus awajinensis	Mycobacterium kansasii	Mycobacterium kansasii	IC90= 0.78 μg/mL(90%)	Both	NA	NA	NA	ICR/JCL male mice and male beagle dogs	15 mg/kg for mice and 50mg/kg for dog	NA	NA	NA	NA	NA	1988	3348603
antitb_1341	Dihydromycoplanecin A	R-N(CH3)-CH(CH-CH3-CH3)-CO-N(CH-C-CH2-CH3-C-CH)-CO-N(CH3)-CH-C)-NH-CH(CH2-CH-CH3-CH3)-CO-N-CH-C-CH3_C-CH)-CONH-CH(CH2-CH2-CH-CH3-CH3)-Co-N-CH3-Ch-CH(CH3-CH3)-Co-N-(CH-C-Ch)-Co-N(CH3)-CH(CH2-CH-CH3-CH3)-CO-NH-CH2-CO-O-CH(CH3)	Propanol is attached	Free	R =CH3-CH2-CH(OH)-CO	Cyclic	21	Mix	NA	Natural	Aspergillus awajinensis	Mycobacterium bovis	Mycobacterium tuberculosis H37Rv	NA	Both	NA	NA	NA	ICR/JCL Mice	15 mg/kg for mice and 50mg/kg for dog	NA	NA	NA	4mg of DHMPA peptide+ 0.1 mg of Isoniazid	NA	1988	3348603
antitb_1342	Dihydromycoplanecin A	R-N(CH3)-CH(CH-CH3-CH3)-CO-N(CH-C-CH2-CH3-C-CH)-CO-N(CH3)-CH-C)-NH-CH(CH2-CH-CH3-CH3)-CO-N-CH-C-CH3_C-CH)-CONH-CH(CH2-CH2-CH-CH3-CH3)-Co-N-CH3-Ch-CH(CH3-CH3)-Co-N-(CH-C-Ch)-Co-N(CH3)-CH(CH2-CH-CH3-CH3)-CO-NH-CH2-CO-O-CH(CH3)	Propanol is attached	Free	R =CH3-CH2-CH(OH)-CO	Cyclic	21	Mix	NA	Natural	Aspergillus awajinensis	Mycobacterium tuberculosis	Mycobacterium tuberculosis R-KM	NA	Both	NA	NA	NA	ICR/JCL Mice	15 mg/kg for mice and 50mg/kg for dog	NA	NA	NA	4mg of DHMPA peptide+ 0.1 mg of Isoniazid	NA	1988	3348603
antitb_1343	Dihydromycoplanecin A	R-N(CH3)-CH(CH-CH3-CH3)-CO-N(CH-C-CH2-CH3-C-CH)-CO-N(CH3)-CH-C)-NH-CH(CH2-CH-CH3-CH3)-CO-N-CH-C-CH3_C-CH)-CONH-CH(CH2-CH2-CH-CH3-CH3)-Co-N-CH3-Ch-CH(CH3-CH3)-Co-N-(CH-C-Ch)-Co-N(CH3)-CH(CH2-CH-CH3-CH3)-CO-NH-CH2-CO-O-CH(CH3)	Propanol is attached	Free	R =CH3-CH2-CH(OH)-CO	Cyclic	21	Mix	NA	Natural	Aspergillus awajinensis	Mycobacterium smegmatis	Mycobacterium smegmatis ATCC 607	FIC= 0.250 - 0.375	NA	NA	NA	NA	NA	NA	NA	NA	NA	DHMPA+ Isoniazid	NA	1988	3348603
antitb_1345	Tenecin 1 fragment 17-27	DAACAAHCLFR	Free	Amidation	Internal disulphide bond	Cyclic	11	NA	NA	Natural	Larvae of tenebrio molitor(beetle)	Mycobacterium smegmatis	Mycobacterium smegmatis ATCC 608	MIC = >100 μg/ml	in vitro	Human erythrocyte	NA	None	NA	NA	NA	Membrane disruption as reported by membrane leaky assay	NA	NA	None	1998	9693108
antitb_1349	Tenecin 1 Fragment 33-43	YCNGKRVCVC	Free	Amidation	Internal disulphide bond	Cyclic	10	NA	NA	Natural	Larvae of tenebrio molitor(beetle)	Mycobacterium smegmatis	Mycobacterium smegmatis ATCC 612	MIC = >100 μg/ml	in vitro	Human erythrocyte	NA	None	NA	NA	NA	Membrane disruption as reported by membrane leaky assay	NA	NA	Antibacterial against MRSA, bacillus subtilis, E.coli, Shigella at 10-30 μg/ml	1998	9693108
antitb_1354	Nk-lysin	NEDTVTQAASRVCDKMKILRGVCKKIMRTFLRRISKD	Free	Free	Internal disuphide bond 13 -23	Cyclic	37	L	NA	Natural	Pig cytolytic lymphocytes	Mycobacterium tuberculosis	Mycobacterium tuberculosis H37Rv ATCC 25618	IC90 = 30 μM	In vitro	Human erythroleukaemia cell line K562	NA	30 % cytolytic activity in range of 3 -7 μM peptide concentration	NA	NA	NA	NA	NA	NA	Antibacterial against bacillus megaterium, E.coli, P.aeuroginosaand S.aureus	1999	10585872
antitb_1355	NKLF1	VTQAASRVCDKMKILRGVCKKIMRTFLRR	Free	Free	Internal disulphide bond at residue between 9-13	Cyclic	29	L	NA	Natural	Pig cytolytic lymphocytes	Mycobacterium tuberculosis	Mycobacterium tuberculosis H37Rv ATCC 25619	IC90 = 30 μM	In vitro	Human erythroleukaemia cell line K562	NA	31 % cytolytic activity in range of 3 -7 μM peptide concentration	NA	NA	NA	NA	NA	NA	Antibacterial against bacillus megaterium, E.coli, P.aeuroginosaand S.aureus	1999	10585872
antitb_1356	NKLF2	VCDKMKILRGVCKKIMRTFLRR	Free	Free	None	Cyclic	22	L	NA	Natural	Pig cytolytic lymphocytes	Mycobacterium tuberculosis	Mycobacterium tuberculosis H37Rv ATCC 25620	IC90 = 30 μM	In vitro	Human erythroleukaemia cell line K562	NA	32 % cytolytic activity in range of 3 -7 μM peptide concentration	NA	NA	NA	NA	NA	NA	Antibacterial against bacillus megaterium, E.coli, P.aeuroginosaand S.aureus	1999	10585872
antitb_1357	Gran F2	VCRTGRSRWRDVCRNFMRRYQSR	Free	Free	Internal disulphide bond at residue between 2-13	Cyclic	23	L	NA	Natural	Human cytolytic lymphocytes	Mycobacterium tuberculosis	Mycobacterium tuberculosis H37Rv ATCC 25621	IC90 = 30 μM	In vitro	Human erythroleukaemia cell line K562	NA	33 % cytolytic activity in range of 3 -7 μM peptide concentration	NA	NA	NA	NA	NA	NA	Antibacterial against bacillus megaterium, E.coli, P.aeuroginosaand S.aureus	1999	10585872
antitb_1370	Human neutrophil peptides-1	ACYCRIPACIAGERRYGTCIYQGRLWAFCC	Free	Free	Disulphide linkage between cys2-cys30, cys4-cys19,cys9-cys29	cyclic	30	L	Cationic	Synthetic	Human neutrophils	Mycobacterium tuberculosis	Mycobacterium tuberculosis H37 Ra	NA	in vitro	None	NA	NA	NA	NA	NA	NA	Mycobacterial genomic DNA	NA	antibacterial against candida albicans	2000	11375668
antitb_1388	Hepcidin	DTHFPICIFCCGCCHRSKCGMCCKT	Free	Free	Disulphide linkage between cys7-23, cys10-13, cys11-19,cys14-22	Cyclic	25	L	Cationic	Natural	Human alveolar type 2 epithilium	Mycobacterium tuberculosis	Mycobacterium H37Rv	NA	in vivo	A549 cell line	NA	No cytotoxicity	BALB/C	NA	Increased production of TNF-α, IL-1α	NA	Mycobacterium tuberculosis + IFN-Υ		antimicrobial	2011	21482189
antitb_1477	Nocathiacins	not available	NA	NA	NA	Branched cyclic	0	NA	Cationic	Natural	Derived from Nocardia species	Mycobacterium pneumoniae	Mycobacterium pneumoniae	MIC = ≤0.008 mg/ml	in vitro	McCoy cell lines	NA	0.25 μg/ml	NA	NA	NA	Bind to the 23S rRNA of the 50S ribosomal subunit and inhibit translation	23srRNA subunit of bacteria	NA	NA	2015	25681127
antitb_1478	Lariatin A	GSQLVYRWVGHSNVIKGP	NA	NA	Alpha carbon of glutamine form amide bond with first glycine and gamma carbon of glutamine involved in side chain formation	Cyclic	18	D	Cationic	Natural	Derived from Rhodococcusjostii K01‐B0171	Mycobacterium tuberculosis	Mycobacterium tuberculosis Rv	MIC = 0.39 mg/L	in vitro	NA	NA	NA	NA	NA	NA	Inhibit cell wall biosynthesis	NA	NA	NA	2015	25681127
antitb_1479	Dihydromycoplanecin A (DHMP A)	not available	NA	NA	NA	Branched cyclic	0	D	Cationic	Natural	Derived from Actinoplanesawajinensis	Mycobacterium tuberculosis	Mycobacterium tuberculosis Rv	IC50= 0.0125-25mg/ml	in vitro	NA	NA	NA	NA	NA	NA	NA	NA	NA	NA	2015	25681127
antitb_1480	Dihydromycoplanecin A (DHMP A)	not available	NA	NA	NA	Branched cyclic	0	D	Cationic	Natural	Derived from Actinoplanesawajinensis	Mycobacterium tuberculosis	Mycobacterium tuberculosis Rv	IC90= 0.05 μg/mL	in vitro	NA	NA	NA	NA	NA	NA	NA	NA	NA	NA	2015	25681127
antitb_1481	Dihydromycoplanecin A (DHMP A)	not available	NA	NA	NA	Branched cyclic	0	D	Cationic	Natural	Derived from Actinoplanesawajinensis	Mycobacterium intracellulare	Mycobacterium intracellulare	IC50= 1.56 μg/ml	in vitro	NA	NA	NA	NA	NA	NA	NA	NA	NA	NA	2015	25681127
antitb_1482	Dihydromycoplanecin A (DHMP A)	not available	NA	NA	NA	Branched cyclic	0	D	Cationic	Natural	Derived from Actinoplanesawajinensis	Mycobacterium intracellulare	Mycobacterium intracellulare	IC90= 25 μg/mL	in vitro	NA	NA	NA	NA	NA	NA	NA	NA	NA	NA	2015	25681127
antitb_1483	Dihydromycoplanecin A (DHMP A)	not available	NA	NA	NA	Branched cyclic	0	D	Cationic	Natural	Derived from Actinoplanesawajinensis	Mycobacteria kansaii	Mycobacteria kansaii	IC50= 0.39 μg/mL	in vitro	NA	NA	NA	NA	NA	NA	NA	NA	NA	NA	2015	25681127
antitb_1484	Dihydromycoplanecin A (DHMP A)	not available	NA	NA	NA	Branched cyclic	0	D	Cationic	Natural	Derived from Actinoplanesawajinensis	Mycobacteria kansaii	Mycobacteria kansaii	IC90= 0.78 μg/mL	in vitro	NA	NA	NA	NA	NA	NA	NA	NA	NA	NA	2015	25681127