Browse result page of AntiTbPdb
The total number entries retrieved from this search are 202
ID | Name | Sequence | N-Terminal Modification | C-Terminal Modification | Chemical Modification | Linear/Cyclic | Length | Chirality | Nature | Source | Origin | Species | Strain | Inhibition Concentration | In vitro/ In vivo | Cell Line | Intracellular Inhibition | Cytotoxicity | Animal Model | Effective Dose in model organism | Immune Responce | Mechanism of Action | Target | Combination Therapy | Other Activities | Year of Publication | Pubmed ID/ Patent No. |
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
antitb_1131 | PR-39 | RRRPRPPYLPRPRPPPFFPPRLPPRIPPGFPPRFPPRFP | Free | Amidation | None | Linear | 39 | L | Amphipathic | Natural | Isolated from porcine leucocytes | Mycobacterium smegmatis | Mycobacterium smegmatis (ATCC 19420) | IC90 = 50mg/L | In vitro | None | NA | NA | None | NA | NA | Disrupt the membrane architecture | Cell envelope | None | Antibacterial against salmonella, staphylococcus and neisseria | 2001 | 11328767 |
antitb_1136 | NK-2 | KILRGVCKKIMRTFLRRISKDILTGKK | Free | Amidation | None | Linear | 27 | L | Cationic | Protein Derived | Core region of the lymphocytic effector protein NK-lysin, found in NK cells and cytotoxic T cells | Mycobacterium smegmatis | Mycobacterium smegmatis mc2155 (ATCC 700084) | 17.5 μg of NK-2/ml killed >90% M. smegmatis population after 24 h of incubation | In vitro | RAW264.7 | No significant reduction in intracellular survival of M. smegmatis was observed | No significant reduction in cell viability upto 100 μg/ml | None | NA | NA | Permeabilization of the bacterial cell membrane | Cell envelope | None | Antibacterial, Antiprotozoan (Trypanosoma cruzi and Plasmodium falciparum) and antifungal (Candida albicans) | 2013 | 23689720 |
antitb_1137 | NK-2 | KILRGVCKKIMRTFLRRISKDILTGKK | Free | Amidation | None | Linear | 27 | L | Cationic | Protein Derived | Core region of the lymphocytic effector protein NK-lysin, found in NK cells and cytotoxic T cells | Mycobacterium smegmatis | Mycobacterium smegmatis mc2155 (ATCC 700084) | 7 μg of NK- 2/ml combined with 0.5 ppm of NP-1 kills 90% of M. smegmatis | In vitro | RAW264.7 | Combination of NP-1 and NK-2 showed 35% reduction in intracellular survival of M. smegmatis | No significant reduction in cell viability either treating alone or combination | None | NA | NA | Permeabilization of the bacterial cell membrane | Cell envelope | AgNPs synthesiszed only in the presence of a plant Alstonia macrophylla (NP-1). | Antibacterial, Antiprotozoan (Trypanosoma cruzi and Plasmodium falciparum) and antifungal (Candida albicans) | 2013 | 23689720 |
antitb_1138 | NK-2 | KILRGVCKKIMRTFLRRISKDILTGKK | Free | Amidation | None | Linear | 27 | L | Cationic | Protein Derived | Core region of the lymphocytic effector protein NK-lysin, found in NK cells and cytotoxic T cells | Mycobacterium smegmatis | Mycobacterium smegmatis mc2155 (ATCC 700084) | 7 μg of NK- 2/ml combined with 0.5 ppm of NP-2 kills 90% of M. smegmatis | In vitro | RAW264.7 | NP-2 in combination with NK-2 killed >52% intra- cellular M. smegmatis. | No significant reduction in cell viability either treating alone or combination | None | NA | NA | Permeabilization of the bacterial cell membrane | Cell envelope | AgNPs synthesiszed only in the presence of a fungal Trichoderma sp. (NP-2). | Antibacterial, Antiprotozoan (Trypanosoma cruzi and Plasmodium falciparum) and antifungal (Candida albicans) | 2013 | 23689720 |
antitb_1140 | LLKKK-18 | KEFKRIVKRIKKFLRKL | Free | Free | None | Linear | 17 | L | Amphipathic | Protein Derived | Variant of LL-37 | Mycobacterium smegmatis | Mycobacterium smegmatis mc2155 (ATCC 700084) | 25 μg of LLKKK-18/ml killed >80% of M. smegmatis after 24 h | In vitro | RAW264.7 | No significant reduction in intracellular survival of M. smegmatis was observed | No significant reduction in cell viability upto 25 μg/ml | None | NA | NA | Permeabilization of the bacterial cell membrane | Cell envelope | None | None | 2013 | 23689720 |
antitb_1141 | LLKKK-18 | KEFKRIVKRIKKFLRKL | Free | Free | None | Linear | 17 | L | Amphipathic | Protein Derived | Variant of LL-38 | Mycobacterium smegmatis | Mycobacterium smegmatis mc2155 (ATCC 700084) | 0.5 ppm of NP-1 combined with 1 μg/ml of LLKKK-18 kills 50% of M. smegmatis | In vitro | RAW264.7 | NP-1 in combination with LLKKK-18 kills 65% of mycobacteria compared to NP-1 or LLKKK-18 alone. | No significant reduction in cell viability either treating alone or combination | None | NA | NA | Permeabilization of the bacterial cell membrane | Cell envelope | AgNPs synthesiszed only in the presence of a plant Alstonia macrophylla (NP-1). | None | 2013 | 23689720 |
antitb_1142 | LLKKK-18 | KEFKRIVKRIKKFLRKL | Free | Free | None | Linear | 17 | L | Amphipathic | Protein Derived | Variant of LL-39 | Mycobacterium smegmatis | Mycobacterium smegmatis mc2155 (ATCC 700084) | 0.5 ppm of NP-2 combined with 1 μg/ml of LLKKK-18 kills 89% of M. smegmatis | In vitro | RAW264.7 | No significant reduction | No significant reduction in cell viability either treating alone or combination | None | NA | NA | Permeabilization of the bacterial cell membrane | Cell envelope | AgNPs synthesiszed only in the presence of a fungal Trichoderma sp. (NP-2). | None | 2013 | 23689720 |
antitb_1144 | Nisin A | I-(Dhb)-AI-(Dha)-LA-(Abu)-PGAK-(Abu)-GALMGANMK-(Abu)-A-(Abu)-ANASIHV-(Dha)-K | Free | Free | Dha= Didehydroalanine, Dhb= Didehydroaminobutyric acid, Abu= 2-aminobutyric acid, Lanthionine (Ala-S-Ala) formation from 3-7 Ala, and β-methyllanthionine (Abu-S-Ala) from 8-11, 13-19, 23-26, 25-28 in between Abu and Ala | Cyclic (5 hinge region due to presence of lanthion | 34 | L | NA | Natural | Produced by Lactococcus lactis | Mycobacterium smegmatis | Mycobacterium smegmatis mc2155 | NA | In vitro | None | NA | NA | None | NA | NA | NA | NA | None | Antibacterial (Shigella, Pseudomonas and Salmonella, S. aureus, S. agalactiae and L. monocytogenes) | 2010 | 21468208 |
antitb_1149 | Nisin V | I-(Dhb)-AI-(Dha)-LA-(Abu)-PGAK-(Abu)-GALMGANVK-(Abu)-A-(Abu)-ANASIHV-(Dha)-K | Free | Free | Dha= Didehydroalanine, Dhb= Didehydroaminobutyric acid, Abu= 2-aminobutyric acid, Lanthionine (Ala-S-Ala) formation from 3-7 Ala, and β-methyllanthionine (Abu-S-Ala) from 8-11, 13-19, 23-26, 25-28 in between Abu and Ala | Cyclic (5 hinge region dur to presence of lanthion | 34 | L | NA | Natural | Produced by Lactococcus lactis | Mycobacterium smegmatis | Mycobacterium smegmatis MC2155 | 2.2 mm zone of activity as compared to Nisin A | In vitro | None | NA | NA | None | NA | NA | NA | NA | None | Antibacterial (Shigella, Pseudomonas and Salmonella, S. aureus, S. agalactiae and L. monocytogenes) | 2010 | 21468208 |
antitb_1154 | Nisin S | I-(Dhb)-AI-(Dha)-LA-(Abu)-PGAK-(Abu)-GALMGANMS-(Abu)-A-(Abu)-ANASIHV-(Dha)-K | Free | Free | Dha= Didehydroalanine, Dhb= Didehydroaminobutyric acid, Abu= 2-aminobutyric acid, Lanthionine (Ala-S-Ala) formation from 3-7 Ala, and β-methyllanthionine (Abu-S-Ala) from 8-11, 13-19, 23-26, 25-28 in between Abu and Ala | Cyclic (5 hinge region dur to presence of lanthion | 34 | L | NA | Natural | Produced by Lactococcus lactis | Mycobacterium smegmatis | Mycobacterium smegmatis MC2155 | 4 mm zone of activity as compared to Nisin A | In vitro | None | NA | NA | None | NA | NA | NA | NA | None | Antibacterial (Shigella, Pseudomonas and Salmonella, S. aureus, S. agalactiae and L. monocytogenes) | 2010 | 21468208 |
antitb_1159 | Nisin T | I-(Dhb)-AI-(Dha)-LA-(Abu)-PGAK-(Abu)-GALMGANMT-(Abu)-A-(Abu)-ANASIHV-(Dha)-K | Free | Free | Dha= Didehydroalanine, Dhb= Didehydroaminobutyric acid, Abu= 2-aminobutyric acid, Lanthionine (Ala-S-Ala) formation from 3-7 Ala, and β-methyllanthionine (Abu-S-Ala) from 8-11, 13-19, 23-26, 25-28 in between Abu and Ala | Cyclic (5 hinge region dur to presence of lanthion | 34 | L | NA | Natural | Produced by Lactococcus lactis | Mycobacterium smegmatis | Mycobacterium smegmatis MC2155 | 2.7 mm zone of activity as compared to Nisin A | In vitro | None | NA | NA | None | NA | NA | NA | NA | None | Antibacterial (Shigella, Pseudomonas and Salmonella, S. aureus, S. agalactiae and L. monocytogenes) | 2010 | 21468208 |
antitb_1196 | Boropentapeptide | AVKAA-B(OH)2 | Free | Conjugated with Boronic acid | Conjugated with Boronic acid | Linear | 5 | L | NA | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis | Poorer inhibition than Pinanediol PD-protected Boropentapeptide | In vitro | None | NA | NA | None | NA | NA | Inhibit enzyme (MycP1) reponsible for cleavage of virulence factor (ESX secretion-associated protein B (EspB)) | Mycosin protease-1 (MycP1) | None | None | 2014 | 24915878 |
antitb_1199 | Pinanediol PD-protected Boropentapeptide | AVKAA-BO2(PD) | Free | Conjugated with Boronic acid and pinanediol PD | Conjugated with Boronic acid and pinanediol PD | Linear | 5 | L | NA | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis | IC50 = 93.2±33.7 μM for MycP2 | In vitro | None | NA | NA | None | NA | NA | Inhibit enzyme (MycP1) reponsible for cleavage of virulence factor (ESX secretion-associated protein B (EspB)) | Mycosin protease-1 (MycP1) | None | None | 2014 | 24915878 |
antitb_1218 | Lassomycin | GLRRLFADQLVGRRNI-CO2CH3 | Involved in Cyclic formation | Addition of Methyl ester | Formation of an amide bond between N-terminal amine and the side chain carboxyl group of Asp8. | Cyclic | 16 | L | Highly Basic | Natural | Extracts from soil actinomycetes | Mycobacterium smegmatis | Mycobacterium smegmatis | MIC = 0.78-2 μg/ml or 0.41-1.06 μM | In vitro | Human NIH 3T3 and HepG2, erythrocytes | NA | Low cytotoxicty (IC50, 350 μg/ml) against human NIH 3T3 and HepG2 cells | None | NA | NA | Uncoupling ATPase from proteolytic activity | ClpC1 ATPase complex | None | Antibacterial (other actinobacteria, gram positive and gram negative bacteria) | 2014 | 24684906 |
antitb_1230 | (LLKK)2 | LLKKLLKK | Free | Free | None | Linear | 8 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis (ATCC No. 14468) | MIC = 125 mg/L | In vitro | Rat red blood cells (rRBCs) | NA | Very low, i.e. 50% hemolysis concentration (HC50) > 1000 mg/L | None | NA | NA | Membrane-lytic mechanism | Cell envelope | None | Antibacterial | 2014 | 24314557 |
antitb_1234 | C(LLKK)2 | CLLKKLLKK | Free | Free | None | Linear | 9 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis (ATCC No. 14468) | MIC = 62.5 mg/L | In vitro | Rat red blood cells (rRBCs) | NA | Very low, i.e. 50% hemolysis concentration (HC50) > 1000 mg/L | None | NA | NA | Membrane-lytic mechanism | Cell envelope | None | Antibacterial | 2014 | 24314557 |
antitb_1235 | C(LLKK)2 | CLLKKLLKK | Free | Free | None | Linear | 9 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis resistant agianst rifampicin | MIC = 62.5 mg/L | In vitro | Rat red blood cells (rRBCs) | NA | Very low, i.e. 50% hemolysis concentration (HC50) > 1000 mg/L | None | NA | NA | Membrane-lytic mechanism | Cell envelope | None | Antibacterial | 2014 | 24314557 |
antitb_1239 | (LLKK)2C | LLKKLLKKC | Free | Free | None | Linear | 9 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis (ATCC No. 14468) | MIC = 125 mg/L | In vitro | Rat red blood cells (rRBCs) | NA | Very low, i.e. 50% hemolysis concentration (HC50) > 1000 mg/L | None | NA | NA | Membrane-lytic mechanism | Cell envelope | None | Antibacterial | 2014 | 24314557 |
antitb_1240 | C(LLKK)2C | CLLKKLLKKC | Free | Free | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis (ATCC No. 14468) | MIC = 250 mg/L | In vitro | Rat red blood cells (rRBCs) | NA | Very low, i.e. 50% hemolysis concentration (HC50) > 1000 mg/L | None | NA | NA | Membrane-lytic mechanism | Cell envelope | None | Antibacterial | 2014 | 24314557 |
antitb_1241 | M(LLKK)2 | MLLKKLLKK | Free | Free | None | Linear | 9 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis (ATCC No. 14468) | MIC = 125 mg/L | In vitro | Rat red blood cells (rRBCs) | NA | Very low, i.e. 50% hemolysis concentration (HC50) > 1000 mg/L | None | NA | NA | Membrane-lytic mechanism | Cell envelope | None | Antibacterial | 2014 | 24314557 |
antitb_1242 | (LLKK)2M | LLKKLLKKM | Free | Free | None | Linear | 9 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis (ATCC No. 14468) | MIC = 62.5 mg/L | In vitro | Rat red blood cells (rRBCs) | NA | Very low, i.e. 50% hemolysis concentration (HC50) > 1000 mg/L | None | NA | NA | Membrane-lytic mechanism | Cell envelope | None | Antibacterial | 2014 | 24314557 |
antitb_1243 | (LLKK)2M | LLKKLLKKM | Free | Free | None | Linear | 9 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis resistant agianst rifampicin | MIC = 62.5 mg/L | In vitro | Rat red blood cells (rRBCs) | NA | Very low, i.e. 50% hemolysis concentration (HC50) > 1000 mg/L | None | NA | NA | Membrane-lytic mechanism | Cell envelope | None | Antibacterial | 2014 | 24314557 |
antitb_1247 | M(LLKK)2M | MLLKKLLKKM | Free | Free | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis (ATCC No. 14468) | MIC = 62.5 mg/L | In vitro | Rat red blood cells (rRBCs) | NA | Very low, i.e. 50% hemolysis concentration (HC50) > 1000 mg/L | None | NA | NA | Membrane-lytic mechanism | Cell envelope | None | Antibacterial | 2014 | 24314557 |
antitb_1248 | M(LLKK)2M | MLLKKLLKKM | Free | Free | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis (ATCC No. 14468) | MIC = 15.6 mg/L | In vitro | Rat red blood cells (rRBCs) | NA | Very low, i.e. 50% hemolysis concentration (HC50) > 1000 mg/L | None | NA | NA | Membrane-lytic mechanism | Cell envelope | Rifampicin, shows synergy | Antibacterial | 2014 | 24314557 |
antitb_1249 | M(LLKK)2M | MLLKKLLKKM | Free | Free | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis resistant agianst rifampicin | MIC = 62.5 mg/L | In vitro | Rat red blood cells (rRBCs) | NA | Very low, i.e. 50% hemolysis concentration (HC50) > 1000 mg/L | None | NA | NA | Membrane-lytic mechanism | Cell envelope | None | Antibacterial | 2014 | 24314557 |
antitb_1250 | M(LLKK)2M | MLLKKLLKKM | Free | Free | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis resistant agianst rifampicin | MIC = 15.6 mg/L | In vitro | Rat red blood cells (rRBCs) | NA | Very low, i.e. 50% hemolysis concentration (HC50) > 1000 mg/L | None | NA | NA | Membrane-lytic mechanism | Cell envelope | Rifampicin, shows synergy | Antibacterial | 2014 | 24314557 |
antitb_1275 | Inhibitor 4 | Ala(1-naphtyl)-K-boroLeu | Free | Free | Ala(1-naphtyl) = 1-napthylalanine, boroLeu = leucine boronic acid | Linear | 3 | L | NA | Synthetic | substrate-based boronate inhibitors | Mycobacterium smegmatis | Mycobacterium smegmatis strain constitutively expressing GFP-ssrA | MIC50 = 1.5 μM | In vitro | Myeloma cells (MM1.S) | NA | No cytotoxicty | None | NA | NA | Inhibit ClpP1P2 peptidase activity and protein degradation in the presence of ClpC1 and ClpX ATPases. | ClpP1P2 peptidase | None | None | 2015 | 25759383 |
antitb_1284 | Inhibitor 12 | W-(boroMet) | Addition of N-(2-(3,5-Difluorophenyl)acetyl) | Free | boroMet = methionine boronic acid | Linear | 2 | L | NA | Synthetic | substrate-based boronate inhibitors | Mycobacterium smegmatis | Mycobacterium smegmatis strain constitutively expressing GFP-ssrA | MIC50 = 12 μM | In vitro | Myeloma cells (MM1.S) | NA | No cytotoxicty | None | NA | NA | Inhibit ClpP1P2 peptidase activity and protein degradation in the presence of ClpC1 and ClpX ATPases. | ClpP1P2 peptidase | None | None | 2015 | 25759383 |
antitb_1293 | Trichoderins A | (MDA)-P-(AHMOD)-(Aib)-(Aib)-I-V-(Aib)-(Aib)-(AMAE) | Addition of MDA = 2-methyl decanoic acid. | Addition of AMAE = 2-[(20-aminopropyl) methylamino] ethanol. | AHMOD = 2-amino-6-hydroxy-4-methyl-8-oxodecanoic acid, Aib = α-amino- isobutyric acid | Linear | 8 | L | NA | Natural | Isolated from a culture of marine sponge derived fungus of Trichoderma sp. | Mycobacterium smegmatis | Mycobacterium smegmatis | MIC = 0.1 μg/mL | In vitro | None | NA | NA | None | NA | NA | NA | NA | None | None | 2010 | 20483615 |
antitb_1296 | Trichoderins A1 | (MDA)-P-(AMOD)-(Aib)-(Aib)-I-V-(Aib)-(Aib)-(AMAE) | Addition of MDA = 2-methyl decanoic acid. | Addition of AMAE = 2-[(20-aminopropyl) methylamino] ethanol. | AMOD = 2-amino-4-methy1-8-oxodec-6-enoic acid, Aib = a-amino- isobutyric acid, | Linear | 8 | L | NA | Natural | Isolated from a culture of marine sponge derived fungus of Trichoderma sp. | Mycobacterium smegmatis | Mycobacterium smegmatis | MIC = 1.56 μg/mL | In vitro | None | NA | NA | None | NA | NA | NA | NA | None | None | 2010 | 20483615 |
antitb_1299 | Trichoderins B | (MDA)-P-(AHMOD)-(Aib)-(Aib)-V-V-(Aib)-(Aib)-(AMAE) | Addition of MDA = 2-methyl decanoic acid. | Addition of AMAE = 2-[(20-aminopropyl) methylamino] ethanol. | AHMOD = 2-amino-6-hydroxy-4-methyl-8-oxodecanoic acid, Aib = α-amino- isobutyric acid | Linear | 8 | L | NA | Natural | Isolated from a culture of marine sponge derived fungus of Trichoderma sp. | Mycobacterium smegmatis | Mycobacterium smegmatis | MIC =0.63 μg/mL | In vitro | None | NA | NA | None | NA | NA | NA | NA | None | None | 2010 | 20483615 |
antitb_1302 | Ubiquitin-derived peptide (Ub2) | STLHLVLRLRGG | Free | Free | None | Linear | 12 | L | Cationic | Natural | Ubiquitin derived | Mycobacterium smegmatis | M. smegmatis mc2 155 | 1.5 fold reduction in bacterial colony as compared to control at 50 μM of peptide | In vitro | NA | NA | NA | NA | NA | NA | Pore formation in Mycobacterial membrane | mspA gene which form porins in membrane, peptide increase the expression of this gene | NA | NA | 2009 | 19682257 |
antitb_1303 | Ubiquitin-derived peptide (Ub2) | STLHLVLRLRGG | Free | Free | None | Linear | 12 | L | Cationic | Natural | Ubiquitin derived | Mycobacterium smegmatis | M. smegmatis mc2 155 | 1.5 fold reduction in bacterial colony as compared to control at 60 μM of peptide | In vitro | NA | NA | NA | NA | NA | NA | Pore formation in Mycobacterial membrane | mspA gene which form porins in membrane, peptide increase the expression of this gene | NA | NA | 2009 | 19682257 |
antitb_1304 | Ubiquitin-derived peptide (Ub2) | STLHLVLRLRGG | Free | Free | None | Linear | 12 | L | Cationic | Natural | Ubiquitin derived | Mycobacterium smegmatis | M. smegmatis mc2 155 | 2.5 fold reduction in bacterial colony as compared to control at75 μM | In vitro | NA | NA | NA | NA | NA | NA | Pore formation in Mycobacterial membrane | mspA gene which form porins in membrane, peptide increase the expression of this gene | NA | NA | 2009 | 19682257 |
antitb_1305 | Ubiquitin-derived peptide (Ub2) | STLHLVLRLRGG | Free | Free | None | Linear | 12 | L | Cationic | Natural | Ubiquitin derived | Mycobacterium smegmatis | M. smegmatis mc2 155 | 3 fold reduction in bacterial colony as compared to control at100 μM | In vitro | NA | NA | NA | NA | NA | NA | Pore formation in Mycobacterial membrane | mspA gene which form porins in membrane, peptide increase the expression of this gene | NA | NA | 2009 | 19682257 |
antitb_1343 | Dihydromycoplanecin A | R-N(CH3)-CH(CH-CH3-CH3)-CO-N(CH-C-CH2-CH3-C-CH)-CO-N(CH3)-CH-C)-NH-CH(CH2-CH-CH3-CH3)-CO-N-CH-C-CH3_C-CH)-CONH-CH(CH2-CH2-CH-CH3-CH3)-Co-N-CH3-Ch-CH(CH3-CH3)-Co-N-(CH-C-Ch)-Co-N(CH3)-CH(CH2-CH-CH3-CH3)-CO-NH-CH2-CO-O-CH(CH3) | Propanol is attached | Free | R =CH3-CH2-CH(OH)-CO | Cyclic | 21 | Mix | NA | Natural | Aspergillus awajinensis | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC 607 | FIC= 0.250 - 0.375 | NA | NA | NA | NA | NA | NA | NA | NA | NA | DHMPA+ Isoniazid | NA | 1988 | 3348603 |
antitb_1344 | Tenecin 1 fragment 1-15 | VTCDILSVEAKGVKL | Free | Amidation | None | Linear | 15 | NA | NA | Natural | Larvae of tenebrio molitor(beetle) | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC 607 | MIC = >100 μg/ml | in vitro | Human erythrocyte | NA | None | NA | NA | NA | Membrane disruption as reported by membrane leaky assay | NA | NA | None | 1998 | 9693108 |
antitb_1345 | Tenecin 1 fragment 17-27 | DAACAAHCLFR | Free | Amidation | Internal disulphide bond | Cyclic | 11 | NA | NA | Natural | Larvae of tenebrio molitor(beetle) | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC 608 | MIC = >100 μg/ml | in vitro | Human erythrocyte | NA | None | NA | NA | NA | Membrane disruption as reported by membrane leaky assay | NA | NA | None | 1998 | 9693108 |
antitb_1346 | Tenecin 1 fragment 16-32 | DAACAAHCLFR | Free | Amidation | None | Linear | 11 | NA | NA | Natural | Larvae of tenebrio molitor(beetle) | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC 609 | MIC = >100 μg/ml | in vitro | Human erythrocyte | NA | None | NA | NA | NA | Membrane disruption as reported by membrane leaky assay | NA | NA | NA | 1998 | 9693108 |
antitb_1347 | Tenecin 1 fragment 29-43 | NDAACAAHCLFRGRSGG | Free | Amidation | None | Linear | 17 | NA | NA | Natural | Larvae of tenebrio molitor(beetle) | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC 610 | MIC = >100 μg/ml | in vitro | Human erythrocyte | NA | None | NA | NA | NA | Membrane disruption as reported by membrane leaky assay | NA | NA | Antibacterial against MRSA, bacillus subtilis, E.coli, Shigella at 10-30 μg/ml | 1998 | 9693108 |
antitb_1348 | Tenecin 1 Fragment 33-42 | RSGGYCNGKRVCVCR | Free | Amidation | None | Linear | 15 | NA | NA | Natural | Larvae of tenebrio molitor(beetle) | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC 611 | MIC = >100 μg/ml | in vitro | Human erythrocyte | NA | None | NA | NA | NA | Membrane disruption as reported by membrane leaky assay | NA | NA | Antibacterial against MRSA, bacillus subtilis, E.coli, Shigella at 10-30 μg/ml | 1998 | 9693108 |
antitb_1349 | Tenecin 1 Fragment 33-43 | YCNGKRVCVC | Free | Amidation | Internal disulphide bond | Cyclic | 10 | NA | NA | Natural | Larvae of tenebrio molitor(beetle) | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC 612 | MIC = >100 μg/ml | in vitro | Human erythrocyte | NA | None | NA | NA | NA | Membrane disruption as reported by membrane leaky assay | NA | NA | Antibacterial against MRSA, bacillus subtilis, E.coli, Shigella at 10-30 μg/ml | 1998 | 9693108 |
antitb_1350 | Tenecin 1 Fragment 34-43 | YCNGKRVCVCR | Free | Amidation | None | Linear | 11 | NA | NA | Natural | Larvae of tenebrio molitor(beetle) | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC 613 | MIC = >100 μg/ml | in vitro | Human erythrocyte | NA | Cytotoxic at >10 μg/ml | NA | NA | NA | Membrane disruption as reported by membrane leaky assay | NA | NA | None | 1998 | 9693108 |
antitb_1351 | Tenecin 1 Fragment 35-43 | CNGKRVCVCR | Free | Amidation | None | Linear | 10 | NA | NA | Natural | Larvae of tenebrio molitor(beetle) | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC 614 | MIC = >100 μg/ml | in vitro | Human erythrocyte | NA | None | NA | NA | NA | Membrane disruption as reported by membrane leaky assay | NA | NA | None | 1998 | 9693108 |
antitb_1352 | Tenecin 1 Fragment 34-42 | NGKRVCVCR | Free | Amidation | None | Linear | 9 | NA | NA | Natural | Larvae of tenebrio molitor(beetle) | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC 615 | MIC = >100 μg/ml | in vitro | Human erythrocyte | NA | None | NA | NA | NA | NA | NA | NA | None | 1998 | 9693108 |
antitb_1353 | Peptide KSl | KKVVFKVKFK | Free | Free | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC 607 | MIC = 6.25μg/ml | In vitro | Mouse erythrocyte | NA | None | NA | NA | NA | NA | NA | NA | antifungal, antibacterial against C.albicans | 1998 | 9756752 |
antitb_1360 | Pleurocidin | GWGSFFKKAAHVGKHVGKAALTHYL | Free | Free | None | Linear | 25 | L | NA | Natural | Pleuronectes americanus | Mycobacterium smegmatis | Mycobacterium smegmatis | MIC = 80 μg/ml | In vitro | None | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial against P.aeruginosa, K.pneumoniae,S.aureus and C.albicans | 2000 | 10898673 |
antitb_1361 | Pleurocidin | GWGSFFKKAAHVGKHVGKAALTHYL | Free | Free | None | Linear | 25 | L | NA | Natural | Pleuronectes americanus | Mycobacterium smegmatis | Mycobacterium smegmatis | MIC = 20 μg/ml | In vitro | None | NA | NA | NA | NA | NA | NA | NA | 185 μM OF D-CYCLOSERINE DRUG + 5.2 μM OF Peptide reduces ~ 4 time MIC of drug | Antibacterial against P.aeruginosa, K.pneumoniae,S.aureus and C.albicans | 2000 | 10898673 |
antitb_1368 | Thymus peptide | not available | NA | NA | None | NA | 0 | NA | NA | Natural | calf thymus | Mycobacterium smegmatis | Mycobacterium smegmatis Saprophyte | MIC = 300 μg/ml | In vitro | None | NA | NA | NA | NA | NA | NA | NA | NA | NA | 1953 | 13118063 |
antitb_1389 | LL-37 | [LL-37, 37 aa] | Free | Free | None | Linear | 38 | L | Cationic | Natural | Murine macrophages | Mycobacteria smegmatis | M. smegmatis mc2 155 | MIC = 1μg /ml | in vitro | J774.A1 macrophage cell lines | 14% bacteria is cleared | NA | NA | NA | NA | NA | NA | NA | NA | 2011 | 21790937 |