Browse result page of AntiTbPdb
The total number entries retrieved from this search are 202
| ID | Name | Sequence | N-Terminal Modification | C-Terminal Modification | Chemical Modification | Linear/Cyclic | Length | Chirality | Nature | Source | Origin | Species | Strain | Inhibition Concentration | In vitro/ In vivo | Cell Line | Intracellular Inhibition | Cytotoxicity | Animal Model | Effective Dose in model organism | Immune Responce | Mechanism of Action | Target | Combination Therapy | Other Activities | Year of Publication | Pubmed ID/ Patent No. |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| antitb_1390 | LL-37 | [LL-37, 37 aa] | Free | Free | None | Linear | 38 | L | Cationic | Natural | Murine macrophages | Mycobacteria smegmatis | M. smegmatis mc2 155 | MIC = 1μg /ml (after 6 hours) | in vitro | J774.A1 macrophage cell lines | 34% bacteria is cleared | NA | NA | NA | NA | NA | NA | NA | NA | 2011 | 21790937 |
| antitb_1391 | LL-37 | [LL-37, 37 aa] | Free | Free | None | Linear | 38 | L | Cationic | Natural | Murine macrophages | Mycobacteria smegmatis | M. smegmatis mc2 155 | MIC = 25μg/ml | in vitro | J774.A1 macrophage cell lines | 41% bacteria is cleared | NA | NA | NA | NA | NA | NA | NA | NA | 2011 | 21790937 |
| antitb_1392 | LL-37 | [LL-37, 37 aa] | Free | Free | None | Linear | 38 | L | Cationic | Natural | Murine macrophages | Mycobacteria smegmatis | M. smegmatis mc2 155 | MIC = 25μg /ml (after 6 hours incubation) | in vitro | J774.A1 macrophage cell lines | 67% bacteria is cleared | NA | NA | NA | NA | NA | NA | NA | NA | 2011 | 21790937 |
| antitb_1393 | GEK-31 | RKSKEKIGKEFKRIVQR IKDFLRNLVPRTES | Free | Free | None | Linear | 33 | L | Cationic | Natural | Murine macrophages | Mycobacteria smegmatis | M. smegmatis mc2 155 | NA | in vitro | J774.A1 macrophage cell lines | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2011 | 21790937 |
| antitb_1394 | LL-18 | KEFKRIVQRIKDFLRNLV | Free | Free | None | Linear | 19 | L | Cationic | Natural | Murine macrophages | Mycobacteria smegmatis | M. smegmatis mc2 155 | NA | in vitro | J774.A1 macrophage cell lines | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2011 | 21790937 |
| antitb_1395 | LLKKK-18 | KEFKRIVKRIKKFLRKLV | Free | Free | None | Linear | 19 | L | Cationic | Natural | Murine macrophages | Mycobacteria smegmatis | M. smegmatis mc2 155 | MIC = 1μg /ml | in vitro | J774.A1 macrophage cell lines | 67% bacteria is cleared | NA | NA | NA | NA | NA | NA | NA | NA | 2011 | 21790937 |
| antitb_1396 | LLKKK-18 | KEFKRIVKRIKKFLRKLV | Free | Free | None | Linear | 19 | L | Cationic | Natural | Murine macrophages | Mycobacteria smegmatis | M. smegmatis mc2 155 | MIC = 1μg /ml (after 6 hours) | in vitro | J774.A1 macrophage cell lines | 89% bacteria is cleared | NA | NA | NA | NA | NA | NA | NA | NA | 2011 | 21790937 |
| antitb_1397 | LLKKK-18 | KEFKRIVKRIKKFLRKLV | Free | Free | None | Linear | 19 | L | Cationic | Natural | Murine macrophages | Mycobacteria smegmatis | M. smegmatis mc2 155 | MIC = 25μg/ml | in vitro | J774.A1 macrophage cell lines | 81% bacteria is cleared | NA | NA | NA | NA | NA | NA | NA | NA | 2011 | 21790937 |
| antitb_1398 | LLKKK-18 | KEFKRIVKRIKKFLRKLV | Free | Free | None | Linear | 19 | L | Cationic | Natural | Murine macrophages | Mycobacteria smegmatis | M. smegmatis mc2 155 | MIC = 25μg /ml (after 6 hours incubation) | in vitro | J774.A1 macrophage cell lines | 98% bacteria is cleared | NA | NA | NA | NA | NA | NA | NA | NA | 2011 | 21790937 |
| antitb_1401 | LLKKK-18 | KEFKRIVKRIKKFLRKLV | Free | Free | None | Linear | 19 | L | Cationic | Natural | Murine macrophages | Mycobacteria smegmatis | M. smegmatis mc2 155 | MIC = 1μg /ml | in vitro | J774.A1 macrophage cell lines | 51% bacteria is cleared | NA | NA | NA | NA | NA | NA | NA | NA | 2011 | 21790937 |
| antitb_1402 | LLKKK-18 | KEFKRIVKRIKKFLRKLV | Free | Free | None | Linear | 19 | L | Cationic | Natural | Murine macrophages | Mycobacteria smegmatis | M. smegmatis mc2 155 | MIC = 25μg/ml | in vitro | J774.A1 macrophage cell lines | 80% bacteria is cleared | NA | NA | NA | NA | NA | NA | NA | NA | 2011 | 21790937 |
| antitb_1485 | Dihydromycoplanecin A (DHMP A) | not available | NA | NA | NA | Branched cyclic | 0 | D | Cationic | Natural | Derived from Actinoplanesawajinensis | Mycobacteria smegmatis | Mycobacteria smegmatis ATCC 607 | MIC = 12.5 μg/mL | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | DHMP A + INH | NA | 2015 | 25681127 |
| antitb_1506 | SP508A | R-(zDhb)-PVLALVAAVAATSAAY | R =3-hydroxyldodecanoyl | Free | Dhb= Dihydrobutyric acid | Linear | 18 | L | Cationic | Natural | Derived from Pseudomonas syringae | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC14468 | MIC = 31.25 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Specific interaction with membrane | NA | NA | Antibacterial against E.coli, S.aureus, bacillus, pseudomonas | 2015 | 25681127 |
| antitb_1507 | SP508B | R-(zDhb)-PVLALVAAVAATSAAY | R =3-hydroxyldodecanoyl | Free | Dhb= Dihydrobutyric acid, o-C=o linkage between 12 and 16 amino acid residue | Cyclic | 18 | D | Cationic | Natural | Derived from Pseudomonas syringae | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC14468 | MIC = 62.5 μg/ml | in vitro | NA | NA | NA | NA | NA | Specific interaction with membrane | NA | NA | Antibacterial against E.coli, S.aureus, bacillus, pseudomonas | 2015 | 25681127 | |
| antitb_1508 | SP22A | R-(zDhb)-PVVAAVVAVAASAAY | R =3-hydroxyldodecanoyl | Free | Dhb= Dihydrobutyric acid | Linear | 18 | L | Cationic | Natural | Derived from Pseudomonas syringae | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC14468 | MIC = 7.8 μg/ml | in vitro | NA | NA | NA | NA | NA | Specific interaction with membrane | NA | NA | Antibacterial against E.coli, S.aureus, bacillus, pseudomonas | 2015 | 25681127 | |
| antitb_1509 | SP22B | R-(zDhb)-PVVAAVVAVAASAAY | R =3-hydroxyldodecanoyl | Free | Dhb= Dihydrobutyric acid, o-C=o linkage between 12 and 16 amino acid residue | cyclic | 18 | D | Cationic | Natural | Derived from Pseudomonas syringae | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC14468 | MIC = 31.25 μg/ml | in vitro | NA | NA | NA | NA | NA | Specific interaction with membrane | NA | NA | Antibacterial against E.coli, S.aureus, bacillus, pseudomonas | 2015 | 25681127 | |
| antitb_1510 | SP508A | R-(zDhb)-PVLALVAAVAATSAAY | R =3-hydroxyldodecanoyl | Free | Dhb= Dihydrobutyric acid | Linear | 18 | L | Cationic | Natural | Derived from Pseudomonas syringae | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC14468 | Reduction in zone to15 mm at 31.25 mg/L | in vitro | NA | NA | NA | NA | NA | NA | Specific interaction with membrane | NA | NA | Antibacterial against E.coli, S.aureus, bacillus, pseudomonas | 2015 | 25681127 |
| antitb_1511 | SP508B | R-(zDhb)-PVLALVAAVAATSAAY | R =3-hydroxyldodecanoyl | Free | Dhb= Dihydrobutyric acid, o-C=o linkage between 12 and 16 amino acid residue | Cyclic | 18 | D | Cationic | Natural | Derived from Pseudomonas syringae | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC14468 | Reduction in zone to 18 mm at 62.5 mg/L | in vitro | NA | NA | NA | NA | NA | Specific interaction with membrane | NA | NA | Antibacterial against E.coli, S.aureus, bacillus, pseudomonas | 2015 | 25681127 | |
| antitb_1512 | SP22A | R-(zDhb)-PVVAAVVAVAASAAY | R =3-hydroxyldodecanoyl | Free | Dhb= Dihydrobutyric acid | Linear | 18 | L | Cationic | Natural | Derived from Pseudomonas syringae | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC14468 | Reduction in zone to 12 mm 7.8 mg/L | in vitro | NA | NA | NA | NA | NA | Specific interaction with membrane | NA | NA | Antibacterial against E.coli, S.aureus, bacillus, pseudomonas | 2015 | 25681127 | |
| antitb_1513 | SP22B | R-(zDhb)-PVVAAVVAVAASAAY | R =3-hydroxyldodecanoyl | Free | Dhb= Dihydrobutyric acid, o-C=o linkage between 12 and 16 amino acid residue | cyclic | 18 | D | Cationic | Natural | Derived from Pseudomonas syringae | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC14468 | Reduction in zone to 14 mm at 31.25 mg/L | in vitro | NA | NA | NA | NA | NA | Specific interaction with membrane | NA | NA | Antibacterial against E.coli, S.aureus, bacillus, pseudomonas | 2015 | 25681127 | |
| antitb_1520 | PR-39 | RRRPRPPYLPRPRPPPFFPPRLPPRIPPGFPPRFPPRFP | Free | Free | None | Linear | 39 | L | Cationic | Natural | Derived from pig porcine | Mycobacterium smegmatis | Mycobacterium smegmatis susceptible strain | 50 mg/L | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial against E.coli, S.aureus, bacillus, pseudomonas | 2015 | 25681127 | |
| antitb_1607 | TP-5 | RKDVY | Free | Amidation | None | Linear | 4 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis RIF-susceptible | MIC = > 1000mg/L | in vitro | RAW 264.7 mouse macrophage | NA | HC50= > 2000 mg/L on Human RBC | NA | NA | Stimulate TNF-α production | Disrupt the mycobacterial membrane | NA | NA | NA | 2014 | 24411680 |
| antitb_1608 | RR-6 | RRRRRR | Free | Amidation | None | Linear | 5 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis RIF-susceptible | MIC = 125 mg/L | in vitro | RAW 264.7 mouse macrophage | NA | HC50= > 2000 mg/L on Human RBC | NA | NA | Stimulate TNF-α production | Disrupt the mycobacterial membrane | NA | NA | NA | 2014 | 24411680 |
| antitb_1609 | RR-11 | RKDVYRRRRRR | Free | Amidation | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis RIF-susceptible | MIC = 125 mg/L | in vitro | RAW 264.7 mouse macrophage | NA | HC50= > 2000 mg/L on Human RBC | NA | NA | Stimulate TNF-α production | Disrupt the mycobacterial membrane | NA | NA | NA | 2014 | 24411680 |
| antitb_1610 | RY-11 | RRRRRRRKDVY | Free | Amidation | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis RIF-susceptible | MIC = 125 mg/L | in vitro | RAW 264.7 mouse macrophage | NA | HC50= > 2000 mg/L on Human RBC | NA | NA | Stimulate TNF-α production | Disrupt the mycobacterial membrane | NA | NA | NA | 2014 | 24411680 |
| antitb_1611 | TP-5 | RKDVY | Free | Amidation | None | Linear | 4 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis RIF-Resistance | NA | in vitro | RAW 264.7 mouse macrophage | NA | HC50= > 2000 mg/L on Human RBC | NA | NA | Stimulate TNF-α production | Disrupt the mycobacterial membrane | NA | NA | NA | 2014 | 24411680 |
| antitb_1612 | RR-6 | RRRRRR | Free | Amidation | None | Linear | 5 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis RIF-Resistance | MIC = 125 mg/L | in vitro | RAW 264.7 mouse macrophage | NA | HC50= > 2000 mg/L on Human RBC | NA | NA | Stimulate TNF-α production | Disrupt the mycobacterial membrane | NA | NA | NA | 2014 | 24411680 |
| antitb_1613 | RR-11 | RKDVYRRRRRR | Free | Amidation | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis RIF-Resistance | MIC = 125 mg/L | in vitro | RAW 264.7 mouse macrophage | NA | HC50= > 2000 mg/L on Human RBC | NA | NA | Stimulate TNF-α production | Disrupt the mycobacterial membrane | NA | NA | NA | 2014 | 24411680 |
| antitb_1614 | RY-11 | RRRRRRRKDVY | Free | Amidation | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis RIF-Resistance | MIC = 125 mg/L | in vitro | RAW 264.7 mouse macrophage | NA | HC50= > 2000 mg/L on Human RBC | NA | NA | Stimulate TNF-α production | Disrupt the mycobacterial membrane | NA | NA | NA | 2014 | 24411680 |
| antitb_1615 | RY-11 | RRRRRRRKDVY | Free | Amidation | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis RIF-Resistance | MIC = 125 mg/L | in vitro | RAW 264.7 mouse macrophage | NA | HC50= > 2000 mg/L on Human RBC | NA | NA | Stimulate TNF-α production | Disrupt the mycobacterial membrane | NA | RR-11 Peptide(31.25 mg/L) + Rifampicin (1.95mg/L) | NA | 2014 | 24411680 |
| antitb_1616 | LK | LLKKLLKK | Free | Amidation | None | Linear | 8 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC14468 | MIC = 125 μg/ml | in vitro | RAW 264.7 mouse macrophage | NA | HC50= >500 μg/ml | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2015 | 26380930 |
| antitb_1617 | PP | PLLKKLLKKP | Free | Amidation | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC14468 | MIC = 250 μg/ml | in vitro | RAW 264.7 mouse macrophage | NA | HC50= >500 μg/ml | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2015 | 26380930 |
| antitb_1618 | CC | CLLKKLLKKC | Free | Amidation | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC14468 | MIC = 250 μg/ml | in vitro | RAW 264.7 mouse macrophage | NA | HC50= >500 μg/ml | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2015 | 26380930 |
| antitb_1619 | II | ILLKKLLKKI | Free | Amidation | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC14468 | MIC = 62.5 μg/ml | in vitro | RAW 264.7 mouse macrophage | NA | HC50= >500 μg/ml | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2015 | 26380930 |
| antitb_1620 | MM | MLLKKLLKKM | Free | Amidation | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC14468 | MIC = 62.5 μg/ml | in vitro | RAW 264.7 mouse macrophage | NA | HC50= >500 μg/ml | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2015 | 26380930 |
| antitb_1621 | WW | WLLKKLLKKW | Free | Amidation | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC14468 | MIC = 62.5 μg/ml | in vitro | RAW 264.7 mouse macrophage | NA | HC50= >500 μg/ml | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2015 | 26380930 |
| antitb_1622 | LK | LLKKLLKK | Free | Amidation | None | Linear | 8 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC14468 | MIC = 62.5 μg/ml | in vitro | RAW 264.7 mouse macrophage | NA | HC50= >500 μg/ml | NA | NA | NA | Bacterial membrane pore formation | NA | Peptide + Rifampicin (0.98 μg/ml) | NA | 2015 | 26380930 |
| antitb_1623 | PP | PLLKKLLKKP | Free | Amidation | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC14468 | MIC = 125 μg/ml | in vitro | RAW 264.7 mouse macrophage | NA | HC50= >500 μg/ml | NA | NA | NA | Bacterial membrane pore formation | NA | Peptide + Rifampicin (0.98 μg/ml) | NA | 2015 | 26380930 |
| antitb_1624 | CC | CLLKKLLKKC | Free | Amidation | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC14468 | MIC = 250 μg/ml | in vitro | RAW 264.7 mouse macrophage | NA | HC50= >500 μg/ml | NA | NA | NA | Bacterial membrane pore formation | NA | Peptide + Rifampicin (0.98 μg/ml) | NA | 2015 | 26380930 |
| antitb_1625 | II | ILLKKLLKKI | Free | Amidation | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC14468 | MIC = 15.6 μg/ml | in vitro | RAW 264.7 mouse macrophage | NA | HC50= >500 μg/ml | NA | NA | NA | Bacterial membrane pore formation | NA | Peptide + Rifampicin (0.98 μg/ml) | NA | 2015 | 26380930 |
| antitb_1626 | MM | MLLKKLLKKM | Free | Amidation | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC14468 | MIC = 15.6 μg/ml | in vitro | RAW 264.7 mouse macrophage | NA | HC50= >500 μg/ml | NA | NA | NA | Bacterial membrane pore formation | NA | Peptide + Rifampicin (0.98 μg/ml) | NA | 2015 | 26380930 |
| antitb_1627 | WW | WLLKKLLKKW | Free | Amidation | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC14468 | MIC = 0.98 μg/ml | in vitro | RAW 264.7 mouse macrophage | NA | >500 μg/ml | NA | NA | NA | Bacterial membrane pore formation | NA | Peptide + Rifampicin (0.98 μg/ml) | NA | 2015 | 26380930 |
| antitb_1628 | LL-37 | [LL-37, 37 aa] | Free | Free | None | Linear | 37 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacteria smegmatis mc2 155 | MIC = 2400 μg/ml | in vitro | J774 macrophage cell lines | NA | IC50= 11226 μg/ml | NA | NA | Stimulation of TNF-α production | inhibit bacterial Atpase activity | NA | NA | NA | 2015 | 26218806 |
| antitb_1629 | LLAP | RKSAKKIGKRAKR | Free | Free | None | Linear | 13 | L | Cationic | Natural | NA | Mycobacterium smegmatis | Mycobacteria smegmatis mc2 155 | MIC = 600 μg/ml | in vitro | J774 macrophage cell lines | NA | IC50= 11226 μg/ml | NA | NA | Stimulation of TNF-α production | inhibit bacterial Atpase activity | NA | NA | NA | 2015 | 26218806 |
| antitb_1654 | Trichoderins A | not available | NA | NA | NA | NA | 0 | NA | NA | Natural | Trichoderma species | Mycobacteria smegmatis | Mycobacteria smegmatis (aerobic) | IC90= 0.1 μg/ml | in vitro | Human THP-1 cell lines | NA | NA | NA | NA | NA | Microbial membrane disruption | NA | NA | NA | 2010 | 20483615 |
| antitb_1657 | Trichoderins A | not available | NA | NA | NA | NA | 0 | NA | NA | Natural | Trichoderma species | Mycobacteria smegmatis | Mycobacteria smegmatis (hypoxic) | IC90= 0.1 μg/ml | in vitro | Human THP-1 cell lines | NA | NA | NA | NA | NA | Microbial membrane disruption | NA | NA | NA | 2010 | 20483615 |
| antitb_1660 | Trichoderins A | not available | NA | NA | NA | NA | 0 | NA | NA | Natural | Trichoderma species | Mycobacteria smegmatis | Mycobacteria smegmatis (aerobic) | IC90= 0.02 μg/ml | in vitro | Human THP-1 cell lines | NA | NA | NA | NA | NA | Microbial membrane disruption | NA | NA | NA | 2010 | 20483615 |
| antitb_1663 | Trichoderins A | not available | NA | NA | NA | NA | 0 | NA | NA | Natural | Trichoderma species | Mycobacteria smegmatis | Mycobacteria smegmatis (hypoxic) | IC90= 0.02 μg/ml | in vitro | Human THP-1 cell lines | NA | NA | NA | NA | NA | Microbial membrane disruption | NA | NA | NA | 2010 | 20483615 |
| antitb_1666 | Trichoderins A | not available | NA | NA | NA | NA | 0 | NA | NA | Natural | Trichoderma species | Mycobacteria smegmatis | Mycobacteria smegmatis (aerobic) | IC90= 0.12 μg/ml | in vitro | Human THP-1 cell lines | NA | NA | NA | NA | NA | Microbial membrane disruption | NA | NA | NA | 2010 | 20483615 |
| antitb_1669 | Trichoderins A | not available | NA | NA | NA | NA | 0 | NA | NA | Natural | Trichoderma species | Mycobacteria smegmatis | Mycobacteria smegmatis (hypoxic) | IC90= 0.12 μg/ml | in vitro | Human THP-1 cell lines | NA | NA | NA | NA | NA | Microbial membrane disruption | NA | NA | NA | 2010 | 20483615 |