Browse result page of AntiTbPdb
The total number entries retrieved from this search are 202
| ID | Name | Sequence | N-Terminal Modification | C-Terminal Modification | Chemical Modification | Linear/Cyclic | Length | Chirality | Nature | Source | Origin | Species | Strain | Inhibition Concentration | In vitro/ In vivo | Cell Line | Intracellular Inhibition | Cytotoxicity | Animal Model | Effective Dose in model organism | Immune Responce | Mechanism of Action | Target | Combination Therapy | Other Activities | Year of Publication | Pubmed ID/ Patent No. |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| antitb_1672 | Lariatin A | GSQLVYRWVGHSNVIKGP | Free | Free | Alpha carbon of glutamine form amide bond with first glycine and gamma carbon of glutamine involved in side chain formation | Cyclic | 18 | D | Cationic | Natural | Rhodococcus jostii B0171 | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC607 | MIC = 10 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2007 | 17617692 |
| antitb_1673 | Lariatin B | GSQLVYRWVGHSNVIKGP | Free | Free | Alpha carbon of glutamine form amide bond with first glycine and gamma carbon of glutamine involved in side chain formation | Cyclic | 18 | NA | Cationic | Natural | Rhodococcus jostii B0171 | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC607 | MIC = 10 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2007 | 17617692 |
| antitb_1677 | Globomycin | not available | NA | NA | NA | Cyclic | 0 | D | Cationic | Natural | Derived from streptomyces halstedii 13912 | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC607 | MIC = >100 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial against bacillus sub!ills , E.coli, S.aureus Antifungal against Aspergillus oryzae SANK 11262, Candida albicans | 1977 | 353012 |
| antitb_1681 | KM-8 | not available | NA | NA | None | NA | 0 | NA | NA | Natural | Streptoverticillium | M. smegmatis | Mycobacterium smegmatis ATCC 607 | MIC = 100 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial against Staphylococcus aureus FDA 209 P, Sarcina lutea PCI 1001, Bacillus subtilis PCI 219, Bacillus cereus var. mycoides, Bacillus agri, Bacillus anthracis, Corynebacterium paurometabolurn, Escherichia coli NIHJ, Klebsiella pneumoniae PCI 602, Shigella flexneri, Xanthomonas oryzae Antifungal Candida albicans, Aspergillus niger, Alternaria kikuchiana, Botrytis cinerea | 1975 | 1184471 |
| antitb_1686 | S-520 | not available | NA | NA | None | NA | 0 | NA | NA | Natural | Streptomyces diastaticus | Mycobacterium smegmatis | Mycobacterium smegmatis | MIC = 10 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial against Bacillus subtilis, Bacillus anthracis, Staphylococcus aureus, Staphylococcus aureus,Streptococcus pyogenes,Diplococcus pneumoniae, Sarcinalutea Corynebacterium diphtheriae | 1970 | 5459623 |
| antitb_1691 | Takaokamycin | not available | NA | NA | None | NA | 0 | NA | NA | Natural | Streptomyces sp. AC-1978, | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC 607 | MIC = >100 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | Staphylococcus aureus ATCC 6538P, S. aureus FDA 209P, Bacillus subtilis ATCC 6633, B. cereus IFO 3001, Micrococcus luteus ATCC 9341, Escherichia coli NIHJ, E. coli NIHJ JC-2, Klebsiella pneumoniae ATCC 10031, Proteus vulgaris IFO 3167, Pseudomonas aeruginosa IFO 3080 | 1984 | 6732903 |
| antitb_1692 | Tuberactinamine N | not available | NA | NA | None | NA | 0 | NA | NA | Natural | Streptomyces griseoverticillatus var. tuberacticus | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC 607 | MIC = 12.5 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | Bactericidal against corneybacterium diptheriae, bacillus subtilis, E.coli, Salmonellatyphosa, klebsiella pneumoniare,proteus vulgaris | 1975 | 28292 |
| antitb_1693 | Tuberactinomycin N | not available | NA | NA | None | NA | 0 | NA | NA | Natural | Streptomyces griseoverticillatus var. tuberacticus | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC 607 | MIC = 12.5 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | Bactericidal against corneybacterium diptheriae, bacillus subtilis, E.coli, Salmonellatyphosa, klebsiella pneumoniare,proteus vulgaris | 1975 | 28292 |
| antitb_1806 | NK-2 | KILRGVCKKIMRTFLRRISKDILTGKK | Free | Amidation | None | Linear | 27 | L | Cationic | Protein Derived | Core region of the lymphocytic effector protein NK-lysin | Mycobacterium smegmatis | Mycobacterium smegmatis mc2155 | After 24 h more than 70% killing of M. smegmatis was found at 30 μM | In vitro | mouse macrophage RAW 264.7 | 10 μM NK-2 diminished the intracellular bacterial loadwhen compared to the untreated macrophages | Non-toxic | NA | NA | NA | NA | NA | NA | NA | 2011 | 21396418 |
| antitb_1808 | Ci-MAM-A24 | WRSLGRTLLRLSHALKPLARRSGW | Free | Amidation | None | Linear | 24 | L | Cationic | Protein Derived | Derived from immune cells of Ciona intestinalis, | Mycobacterium smegmatis | Mycobacterium smegmatis mc2155 | 45% bacterial population was killed at 10 μM peptide incubated for 1 hr | In vitro | mouse macrophage RAW 264.9 | NA | Slight toxic (two-fold decrease in cell viability was observed at 50 μM | NA | NA | NA | NA | NA | NA | NA | 2011 | 21396418 |
| antitb_1816 | ubiquitin-derived peptide Ub2 | STLHLVLRLRGG | Free | Free | None | Linear | 12 | L | Cationic | Protein Derived | Ubiquitin derived | Mycobacterium smegmatis | Mycobacterium smegmatis mc2155 | MIC = 50 μM | In vitro | None | NA | NA | NA | NA | NA | Micellar aggregate channel model | Cytoplasmic membrane | NA | NA | 2012 | 23173767 |
| antitb_1817 | Ub2scr | RLGRLVSLHTLG | Free | Free | None | Linear | 12 | L | Cationic | Synthetic | Analogue of Ub2 | Mycobacterium smegmatis | Mycobacterium smegmatis mc2156 | MIC > 400 μM | In vitro | None | NA | NA | NA | NA | NA | Micellar aggregate channel model | Cytoplasmic membrane | NA | NA | 2012 | 23173767 |
| antitb_1818 | Ub2S1A | ATLHLVLRLRGG | Free | Free | None | Linear | 12 | L | Cationic | Synthetic | Analogue of Ub3 | Mycobacterium smegmatis | Mycobacterium smegmatis mc2157 | MIC = 25 μM | In vitro | None | NA | NA | NA | NA | NA | Micellar aggregate channel model | Cytoplasmic membrane | NA | NA | 2012 | 23173767 |
| antitb_1819 | Ub2T2A | SALHLVLRLRGG | Free | Free | None | Linear | 12 | L | Cationic | Synthetic | Analogue of Ub4 | Mycobacterium smegmatis | Mycobacterium smegmatis mc2158 | MIC = 50 μM | In vitro | None | NA | NA | NA | NA | NA | Micellar aggregate channel model | Cytoplasmic membrane | NA | NA | 2012 | 23173767 |
| antitb_1820 | Ub2L3A | STAHLVLRLRGG | Free | Free | None | Linear | 12 | L | Cationic | Synthetic | Analogue of Ub5 | Mycobacterium smegmatis | Mycobacterium smegmatis mc2159 | MIC = 100 μM | In vitro | None | NA | NA | NA | NA | NA | Micellar aggregate channel model | Cytoplasmic membrane | NA | NA | 2012 | 23173767 |
| antitb_1821 | Ub2H4A | STLALVLRLRGG | Free | Free | None | Linear | 12 | L | Cationic | Synthetic | Analogue of Ub6 | Mycobacterium smegmatis | Mycobacterium smegmatis mc2160 | MIC > 400 μM | In vitro | None | NA | NA | NA | NA | NA | Micellar aggregate channel model | Cytoplasmic membrane | NA | NA | 2012 | 23173767 |
| antitb_1822 | Ub2L5A | STLHAVLRLRGG | Free | Free | None | Linear | 12 | L | Cationic | Synthetic | Analogue of Ub7 | Mycobacterium smegmatis | Mycobacterium smegmatis mc2161 | MIC = 50 μM | In vitro | None | NA | NA | NA | NA | NA | Micellar aggregate channel model | Cytoplasmic membrane | NA | NA | 2012 | 23173767 |
| antitb_1823 | Ub2V6A | STLHLALRLRGG | Free | Free | None | Linear | 12 | L | Cationic | Synthetic | Analogue of Ub8 | Mycobacterium smegmatis | Mycobacterium smegmatis mc2162 | MIC = 25 μM | In vitro | None | NA | NA | NA | NA | NA | Micellar aggregate channel model | Cytoplasmic membrane | NA | NA | 2012 | 23173767 |
| antitb_1824 | Ub2L7A | STLHLVARLRGG | Free | Free | None | Linear | 12 | L | Cationic | Synthetic | Analogue of Ub9 | Mycobacterium smegmatis | Mycobacterium smegmatis mc2163 | MIC = 100 μM | In vitro | None | NA | NA | NA | NA | NA | Micellar aggregate channel model | Cytoplasmic membrane | NA | NA | 2012 | 23173767 |
| antitb_1825 | Ub2R8A | STLHLVLALRGG | Free | Free | None | Linear | 12 | L | Cationic | Synthetic | Analogue of Ub10 | Mycobacterium smegmatis | Mycobacterium smegmatis mc2164 | MIC > 400 μM | In vitro | None | NA | NA | NA | NA | NA | Micellar aggregate channel model | Cytoplasmic membrane | NA | NA | 2012 | 23173767 |
| antitb_1826 | Ub2L9A | STLHLVLRARGG | Free | Free | None | Linear | 12 | L | Cationic | Synthetic | Analogue of Ub11 | Mycobacterium smegmatis | Mycobacterium smegmatis mc2165 | MIC = 50 μM | In vitro | None | NA | NA | NA | NA | NA | Micellar aggregate channel model | Cytoplasmic membrane | NA | NA | 2012 | 23173767 |
| antitb_1827 | Ub2R10A | STLHLVLRLAGG | Free | Free | None | Linear | 12 | L | Cationic | Synthetic | Analogue of Ub12 | Mycobacterium smegmatis | Mycobacterium smegmatis mc2166 | MIC > 400μM | In vitro | None | NA | NA | NA | NA | NA | Micellar aggregate channel model | Cytoplasmic membrane | NA | NA | 2012 | 23173767 |
| antitb_1828 | Ub2G11A | STLHLVLRLRAG | Free | Free | None | Linear | 12 | L | Cationic | Synthetic | Analogue of Ub13 | Mycobacterium smegmatis | Mycobacterium smegmatis mc2167 | MIC > 400 μM | In vitro | None | NA | NA | NA | NA | NA | Micellar aggregate channel model | Cytoplasmic membrane | NA | NA | 2012 | 23173767 |
| antitb_1829 | Ub2G12A | STLHLVLRLRGA | Free | Free | None | Linear | 12 | L | Cationic | Synthetic | Analogue of Ub14 | Mycobacterium smegmatis | Mycobacterium smegmatis mc2168 | MIC > 400 μM | In vitro | None | NA | NA | NA | NA | NA | Micellar aggregate channel model | Cytoplasmic membrane | NA | NA | 2012 | 23173767 |
| antitb_1830 | Peptide Ub 17.1 | KTLTGKTITLE | Free | Free | None | Linear | 11 | L | Cationic | Synthetic | Analogue of Ub15 | Mycobacterium smegmatis | Mycobacterium smegmatis mc2169 | MIC = 50 μM | In vitro | None | NA | NA | NA | NA | NA | Targeting the membrane in a less disruptive manner | Cell Membrane | NA | NA | 2012 | 23173767 |
| antitb_1831 | Peptide Ub 21 | EVEPSDTIENVKAKIQ | Free | Free | None | Linear | 16 | L | Cationic | Synthetic | Analogue of Ub16 | Mycobacterium smegmatis | Mycobacterium smegmatis mc2170 | MIC = 50 μM | In vitro | None | NA | NA | NA | NA | NA | Targeting the membrane in a less disruptive manner | Cell Membrane | NA | NA | 2012 | 23173767 |
| antitb_1860 | Anoplin | GLLKRIKTLL | Free | Amidation | None | Linear | 10 | L | Cationic | Natural | Derived from the venom sac of the solitary wasp, Anoplius samariensis | Mycobacterium smegmatis | Mycobacterium smegmatis mc2 155 | MIC = 200 μg/mL | In vitro | RBC | NA | Non toxic to erythrocytes | NA | NA | NA | NA | NA | NA | Antifungal (C. parapsilosis) and Antibacterial (Escherichia coli DH5a, Pseudomonas aeruginosa PAO, and Zymomonas mobilis ATCC 10988; Gram-positive bacteria: Bacillus subtilis DELTA) | 2016 | 27862650 |
| antitb_1861 | Anoplin | GLLKRIKTLL | Addition of octanoic acid (C8H16O2) | Amidation | None | Linear | 10 | L | Amphipathic | Synthetic | Anlogue of Anoplin | Mycobacterium smegmatis | Mycobacterium smegmatis mc2 156 | MIC = 200 μg/mL | In vitro | RBC | NA | Non toxic to erythrocytes | NA | NA | NA | NA | NA | NA | Antifungal (C. parapsilosis) and Antibacterial (Escherichia coli DH5a, Pseudomonas aeruginosa PAO, and Zymomonas mobilis ATCC 10988; Gram-positive bacteria: Bacillus subtilis DELTA) | 2016 | 27862650 |
| antitb_1862 | Anoplin | GLLKRIKTLL | Addition of decanoic acid (C10H20O2) | Amidation | None | Linear | 10 | L | Amphipathic | Synthetic | Anlogue of Anoplin | Mycobacterium smegmatis | Mycobacterium smegmatis mc2 157 | MIC = 200 μg/mL | In vitro | RBC | NA | Non toxic to erythrocytes | NA | NA | NA | NA | NA | NA | Antifungal (C. parapsilosis) and Antibacterial (Escherichia coli DH5a, Pseudomonas aeruginosa PAO, and Zymomonas mobilis ATCC 10988; Gram-positive bacteria: Bacillus subtilis DELTA) | 2016 | 27862650 |
| antitb_1863 | Anoplin | GLLKFIKKLL | Free | Amidation | None | Linear | 10 | L | Amphipathic | Synthetic | Anlogue of Anoplin | Mycobacterium smegmatis | Mycobacterium smegmatis mc2 158 | MIC = 15 μg/mL | In vitro | RBC | NA | Non toxic to erythrocytes | NA | NA | NA | NA | NA | NA | Antifungal (C. parapsilosis) and Antibacterial (Escherichia coli DH5a, Pseudomonas aeruginosa PAO, and Zymomonas mobilis ATCC 10988; Gram-positive bacteria: Bacillus subtilis DELTA) | 2016 | 27862650 |
| antitb_1864 | Anoplin | KLLKFIKKLL | Free | Amidation | None | Linear | 10 | L | Amphipathic | Synthetic | Anlogue of Anoplin | Mycobacterium smegmatis | Mycobacterium smegmatis mc2 159 | MIC = 15 μg/mL | In vitro | RBC | NA | Non toxic to erythrocytes | NA | NA | NA | NA | NA | NA | Antifungal (C. parapsilosis) and Antibacterial (Escherichia coli DH5a, Pseudomonas aeruginosa PAO, and Zymomonas mobilis ATCC 10988; Gram-positive bacteria: Bacillus subtilis DELTA) | 2016 | 27862650 |
| antitb_1865 | Anoplin | RLLKFIKKLL | Free | Amidation | None | Linear | 10 | L | Amphipathic | Synthetic | Anlogue of Anoplin | Mycobacterium smegmatis | Mycobacterium smegmatis mc2 160 | MIC = 20 μg/mL | In vitro | RBC | NA | Non toxic to erythrocytes | NA | NA | NA | NA | NA | NA | Antifungal (C. parapsilosis) and Antibacterial (Escherichia coli DH5a, Pseudomonas aeruginosa PAO, and Zymomonas mobilis ATCC 10988; Gram-positive bacteria: Bacillus subtilis DELTA) | 2016 | 27862650 |
| antitb_1866 | Anoplin | GLLKFIKKLL | Addition of octanoic acid (C8H16O2) | Amidation | None | Linear | 10 | L | Amphipathic | Synthetic | Anlogue of Anoplin | Mycobacterium smegmatis | Mycobacterium smegmatis mc2 161 | MIC = 5 μg/mL | In vitro | RBC | NA | Non toxic to erythrocytes | NA | NA | NA | NA | NA | NA | Antifungal (C. parapsilosis) and Antibacterial (Escherichia coli DH5a, Pseudomonas aeruginosa PAO, and Zymomonas mobilis ATCC 10988; Gram-positive bacteria: Bacillus subtilis DELTA) | 2016 | 27862650 |
| antitb_1867 | Anoplin | GLLKFIKKLL | Addition of decanoic acid (C10H20O2) | Amidation | None | Linear | 10 | L | Amphipathic | Synthetic | Anlogue of Anoplin | Mycobacterium smegmatis | Mycobacterium smegmatis mc2 162 | MIC = 5 μg/mL | In vitro | RBC | NA | Non toxic to erythrocytes | NA | NA | NA | NA | NA | NA | Antifungal (C. parapsilosis) and Antibacterial (Escherichia coli DH5a, Pseudomonas aeruginosa PAO, and Zymomonas mobilis ATCC 10988; Gram-positive bacteria: Bacillus subtilis DELTA) | 2016 | 27862650 |
| antitb_1868 | Anoplin | GLLKFIKKLL | Addition of dodecanoic acid (C12H24O2) | Amidation | None | Linear | 10 | L | Amphipathic | Synthetic | Anlogue of Anoplin | Mycobacterium smegmatis | Mycobacterium smegmatis mc2 163 | MIC = 5 μg/mL | In vitro | RBC | NA | Non toxic to erythrocytes | NA | NA | NA | NA | NA | NA | Antifungal (C. parapsilosis) and Antibacterial (Escherichia coli DH5a, Pseudomonas aeruginosa PAO, and Zymomonas mobilis ATCC 10988; Gram-positive bacteria: Bacillus subtilis DELTA) | 2016 | 27862650 |
| antitb_1883 | Propeptin | GYPWWDYRDLFGGHTFISP | Involved in Cyclic bond formation between amino acid 1 and 9 | Free | None | Cyclic | 19 | D | NA | Natural | Isolated from Microbispora species SNA-115 | Mycobacterium smegmatis | Mycobacterium smegmatis M341 | MIC90 = 100 μg/mL | In vivo | NA | Treatment of infected Mycobacterium smegmatis with 100 μg/ml of Propeptin decreased approximately 90% of the bacterial load | NA | Silkworm hemolymph infected with mycobacterium smegmatis at (1.25 × 107 CFU) | 1.25 × 107 CFU | NA | NA | NA | None | None | 2017 | 28446822 |
| antitb_1884 | Trichoderins A | PXXXIVXX | Addition of MDA (2-methyl decanoic acid) | Addition of AMAE (2-[(20-aminopropyl) methylamino] ethanol) | Addition of AHMOD at residue 2 (2-amino-6-hydroxy-4-methyl-8-oxodecanoic acid) and AIB (a-aminoisobutyric acid) at 3,4,7, and 8 | Cyclic | 8 | D | NA | Natural | Isolated from Trichoderma species 05FI48 | Mycobacterium smegmatis | Mycobacterium smegmatis | MIC = 0.1 μg/mL | In vitro | NA | Tratment with this concentration inhibit 100% bacterial growth | NA | NA | NA | NA | NA | Lipid bilayer | NA | NA | 2010 | 20483615 |
| antitb_1887 | Trichoderins A1 | PXXXIVXX | Addition of MDA (2-methyl decanoic acid) | Addition of AMAE (2-[(20-aminopropyl) methylamino] ethanol) | Addition of AHMOD at residue 2 (2-amino-6-hydroxy-4-methyl-8-oxodecanoic acid) and AIB (a-aminoisobutyric acid) at 3,4,7, and 8 | Cyclic | 8 | D | NA | Natural | Isolated from Trichoderma species 05FI48 | Mycobacterium smegmatis | Mycobacterium smegmatis M341 | MIC = 1.56 μg/mL | In vitro | NA | Tratment with this concentration inhibit 100% bacterial growth | NA | NA | NA | NA | NA | Lipid bilayer | NA | NA | 2010 | 20483615 |
| antitb_1890 | Trichoderin B | PXXXVVXX | Addition of MDA (2-methyl decanoic acid) | Addition of AMAE (2-[(20-aminopropyl) methylamino] ethanol) | Addition of AHMOD at residue 2 (2-amino-6-hydroxy-4-methyl-8-oxodecanoic acid) and AIB (a-aminoisobutyric acid) at 3,4,7, and 8 | Cyclic | 8 | D | NA | Natural | Isolated from Trichoderma species 05FI48 | Mycobacterium smegmatis | Mycobacterium smegmatis M341 | MIC = 0.63 μg/mL | In vitro | NA | Tratment with this concentration inhibit 100% bacterial growth | NA | NA | NA | NA | NA | Lipid bilayer | NA | NA | 2010 | 20483615 |
| antitb_1912 | None | ILSLRWRWKWWKK | Free | Free | None | Linear | 13 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis | MIC = 8 μM | In vitro | J774.16 mouse macrophages and A549 human lung epithelial cells | NA | No cytotoxicity against J774.16 mouse macrophages and A549 human lung epithelial cells | NA | NA | NA | NA | Lipid bilayer | NA | Antibacterial against Streptococcus pyogenes, Streptococcus agalactiae, Streptococcus pneumoniae ATCC 49619, Klebsiella pneumoniae, Pseudomonas aeruginosa ATCC27853, Bacillus subtilis BGSC 1A1. | 2016 | 26902758 |
| antitb_1915 | Laterosporulin 10 | ACVNQCPDAIDRFIVKDKGCHGVEKKYYKQVYVACMNGQHLYCRTEWGGPCQL | Free | Free | Disulphide bond between residues 2-43, 6-35 and 20-51 | Cyclic | 53 | D | Cationic | Natural | Derived from Brevibacillus species SKDU10 | Mycobacterium smegmatis | Mycobacterium smegmatis MC2 155 | MIC = 45 μM | In vitro and ex vivo | RAW 264.7 murine macrophage | NA | No cytotoxicity upto 40 μM/ml concentration | NA | NA | NA | NA | Cell wall pore formation | 0.00625 μM of rifampicin with 0.25 μM of peptide, a fourfold reduction in MIC of rifampicin against H37 RV | Antibacterial against Staphylococcus aureus MTCC 1430, Bacillus subtilis MTCC 121, Pseudomonas aeruginosa MTCC 1934, Vibrio cholerae MTCC 3904, Escherichia coli MTCC 1610 | 2016 | 27267959 |
| antitb_1949 | YD-1 | APKGVQGPNG | Free | Amidation | None | Linear | 10 | L | NA | Natural | Derived from Bacillus amyloliquefaciens CBSYD1 | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC 9341 | MIC = 8 μg/ml | In vitro | NA | NA | NA | NA | NA | NA | NA | Cell wall pore formation | NA | Antibacterial against gram negative such as Alcaligenes faecalis ATCC 1004, Salmonella Typhimurium KCTC 1925 etc and gram positive bacteria such as Enterococcus faecalis ATCC 29212, Micrococcus luteus ATCC 9341, Staphylococcus aureus KCTC 1928 | 2017 | 28050849 |
| antitb_1970 | CM-II protein, Sarcotoxin IA | GWLKKIGKKIERVGQHTRDATIQGLGIAQQAANVAATARG | Free | Amidation | None | Linear | 40 | L | Cationic | Natural | NIH-Sape-4, an Embryonic Cell Line of Sarcophaga peregrina | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC607 | >100 μg/ml | In vitro | None | None | NA | NA | None | NA | NA | cell wall (lipid bilayer) | NA | Staphylococcus aureus FDA209P, Staphylococcus smith, Micrococcus luteus FDA16, Micrococcus luteus IF03333, Micrococcus luteus PC11001, Bacillus subtilis NRRI B-558, Bacillus subtilis PC1219, Corynebacterium bouis 1810, Corynebacterium michiganense, Xantbmonas oryzae, Pseudomonas lachrymans, Escherichia coli NIHJ, Shigella sonnei JS11746, Proteus vulgaris OX19 | 1988 | 3182836 |
| antitb_1971 | Sapecin | ATCDLLSGTGINHSACAAHCLLRGNRGGYCNGKAVCVCRN | Free | Free | None | Linear | 40 | L | Cationic | Natural | NIH-Sape-4, an Embryonic Cell Line of Sarcophaga peregrina | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC607 | 78 μg/ml | In vitro | None | None | NA | NA | None | NA | NA | cell wall (lipid bilayer) | NA | Staphylococcus aureus FDA209P, Staphylococcus smith, Micrococcus luteus FDA16, Micrococcus luteus IF03333, Micrococcus luteus PC11001, Bacillus subtilis NRRI B-558, Bacillus subtilis PC1219, Corynebacterium bouis 1810, Corynebacterium michiganense, Xantbmonas oryzae, Pseudomonas lachrymans, Escherichia coli NIHJ, Shigella sonnei JS11746, Proteus vulgaris OX19 | 1988 | 3182836 |
| antitb_1974 | KSL | KKVVFKVKFK | Free | Amidation | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC 607 | MIC=6.25µg/ml | In vitro | NA | NA | NA | NA | NA | NA | NA | cell wall | NA | Candida albicans, Shigella flexneri, Proteus vulgaris, Pseudomonas aeruginosa, Escherichia coli, Micrococcus luteus, Staphylococcus epidermidis, MRSA, Staphylococcus aureus | 1998 | 9756752 |
| antitb_1975 | KSL1 | KKVVVKVKFK | Free | Amidation | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC 608 | MIC=3.12µg/ml | In vitro | NA | NA | NA | NA | NA | NA | NA | cell wall | NA | Candida albicans, Shigella flexneri, Proteus vulgaris, Pseudomonas aeruginosa, Escherichia coli, Micrococcus luteus, Staphylococcus epidermidis, MRSA, Staphylococcus aureus | 1998 | 9756752 |
| antitb_1976 | KSL2 | KKVVFKFKFK | Free | Amidation | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC 609 | MIC=3.12µg/ml | In vitro | NA | NA | NA | NA | NA | NA | NA | cell wall | NA | Candida albicans, Shigella flexneri, Proteus vulgaris, Pseudomonas aeruginosa, Escherichia coli, Micrococcus luteus, Staphylococcus epidermidis, MRSA, Staphylococcus aureus | 1998 | 9756752 |
| antitb_1977 | KSL3 | KKLLFKLKFK | Free | Amidation | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC 610 | NA | In vitro | NA | NA | NA | NA | NA | NA | NA | cell wall | NA | Candida albicans, Proteus vulgaris, Pseudomonas aeruginosa, Escherichia coli, Micrococcus luteus, MRSA, Staphylococcus aureus | 1998 | 9756752 |
| antitb_1978 | KSL4 | KKLLFKLKFK | Free | Amidation | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC 611 | NA | In vitro | NA | NA | NA | NA | NA | NA | NA | cell wall | NA | Candida albicans, Proteus vulgaris, Pseudomonas aeruginosa, Escherichia coli, Micrococcus luteus, MRSA, Staphylococcus aureus | 1998 | 9756752 |
| antitb_1979 | KSL5 | KKVVPKVKFK | Free | Amidation | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC 612 | NA | In vitro | NA | NA | NA | NA | NA | NA | NA | cell wall | NA | Candida albicans, Proteus vulgaris, Pseudomonas aeruginosa, Escherichia coli, Micrococcus luteus, MRSA, Staphylococcus aureus | 1998 | 9756752 |