Browse result page of PRRDB 2.0
| PRRID | Name of Ligand | Source of ligand | Sequence of Ligand | Length of Ligand | Type of Ligand | Occurence | Role of Ligand | Name of Receptor | Type of Reeptor | Source of the Receptor | Localization | Domain | Sequence of Receptor | Swiss prot ID | Length of receptor | Function of Receptor | Assay used | PMID | Year of publication | Pubchem assay |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| PRRID_0383 | SIMRA Compound 2 Click for more detail | NA | 5'-UG*CUG*CUUG*UG*-X-G*UG*UUCG*UCG*U-5' | 23 | Nucleic Acid | Synthetic | SIMRA compounds containing arabinonucleotides induced Th1-type cytokine/chemokine profiles in human PBMC cultures such as IL-1β, IL-2R, IL-8, IL-10, IL-12, IFN-α, IFN-γ, MCP-1, RANTES, MIP-1α, MIP-1β, TNF-α. | Toll-like receptor 8 (TLR8) | Toll-like receptor (TLR) | Human | PBMCs | NA | Q9NR97.fasta | Q9NR97 | 1041 | This induces the inflammatory response. | PBMC assay | 19269175 | 2009 | Pubchem Assay |
| PRRID_0383 | SIMRA Compound 2 Click for more detail | NA | 5'-UG*CUG*CUUG*UG*-X-G*UG*UUCG*UCG*U-5' | 23 | Nucleic Acid | Synthetic | SIMRA compounds containing arabinonucleotides induced Th1-type cytokine/chemokine profiles in human PBMC cultures such as IL-1β, IL-2R, IL-8, IL-10, IL-12, IFN-α, IFN-γ, MCP-1, RANTES, MIP-1α, MIP-1β, TNF-α. | Toll-like receptor 8 (TLR8) | Toll-like receptor (TLR) | Human | PBMCs | NA | Q9NR97.fasta | Q9NR97 | 1041 | This induces the inflammatory response. | PBMC assay | 19269175 | 2009 | Pubchem Assay |
| PRRID_0384 | SIMRA Compound 2 Click for more detail | NA | 5'-UG*CUG*CUUG*UG*-X-G*UG*UUCG*UCG*U-5' | 23 | Nucleic Acid | Synthetic | SIMRA compounds containing arabinonucleotides induces the cytokines production in human pDCs cultures such as IFN-γ, IFN-α, IL-12, TNF-α, MIP-1α, MIP-1β. | Toll-like receptor 8 (TLR8) | Toll-like receptor (TLR) | Human | pDCs | NA | Q9NR97.fasta | Q9NR97 | 1041 | This induces the inflammatory response. | NA | 19269175 | 2009 | Pubchem Assay |
| PRRID_0384 | SIMRA Compound 2 Click for more detail | NA | 5'-UG*CUG*CUUG*UG*-X-G*UG*UUCG*UCG*U-5' | 23 | Nucleic Acid | Synthetic | SIMRA compounds containing arabinonucleotides induces the cytokines production in human pDCs cultures such as IFN-γ, IFN-α, IL-12, TNF-α, MIP-1α, MIP-1β. | Toll-like receptor 8 (TLR8) | Toll-like receptor (TLR) | Human | pDCs | NA | Q9NR97.fasta | Q9NR97 | 1041 | This induces the inflammatory response. | NA | 19269175 | 2009 | Pubchem Assay |
| PRRID_0385 | SIMRA Compound 3 Click for more detail | NA | 5'-UGC*UGC*UUGUG-X-GUGUUC*GUC*GU-5' | 23 | Nucleic Acid | Synthetic | Stminulation leads to the activation of NF-kappaB, leads to the release of proinflammatory cytokines | Toll-like receptor 8 (TLR8) | Toll-like receptor (TLR) | Human | HEK293XL cells | NA | Q9NR97.fasta | Q9NR97 | 1041 | This induces the inflammatory response. | NA | 19269175 | 2009 | Pubchem Assay |
| PRRID_0385 | SIMRA Compound 3 Click for more detail | NA | 5'-UGC*UGC*UUGUG-X-GUGUUC*GUC*GU-5' | 23 | Nucleic Acid | Synthetic | Stminulation leads to the activation of NF-kappaB, leads to the release of proinflammatory cytokines | Toll-like receptor 8 (TLR8) | Toll-like receptor (TLR) | Human | HEK293XL cells | NA | Q9NR97.fasta | Q9NR97 | 1041 | This induces the inflammatory response. | NA | 19269175 | 2009 | Pubchem Assay |
| PRRID_0386 | SIMRA Compound 3 Click for more detail | NA | 5'-UGC*UGC*UUGUG-X-GUGUUC*GUC*GU-5' | 23 | Nucleic Acid | Synthetic | Stminulation leads to the activation of NF-kappaB, leads to the release of proinflammatory cytokines | Toll-like receptor 7 (TLR7) | Toll-like receptor (TLR) | Human | HEK293XL cells | NA | Q9NYK1.fasta | Q9NYK1 | 1049 | This induces the inflammatory response. | NA | 19269175 | 2009 | Pubchem Assay |
| PRRID_0386 | SIMRA Compound 3 Click for more detail | NA | 5'-UGC*UGC*UUGUG-X-GUGUUC*GUC*GU-5' | 23 | Nucleic Acid | Synthetic | Stminulation leads to the activation of NF-kappaB, leads to the release of proinflammatory cytokines | Toll-like receptor 7 (TLR7) | Toll-like receptor (TLR) | Human | HEK293XL cells | NA | Q9NYK1.fasta | Q9NYK1 | 1049 | This induces the inflammatory response. | NA | 19269175 | 2009 | Pubchem Assay |
| PRRID_0387 | SIMRA Compound 3 Click for more detail | NA | 5'-UGC*UGC*UUGUG-X-GUGUUC*GUC*GU-5' | 23 | Nucleic Acid | Synthetic | SIMRA compounds containing arabinonucleotides induced Th1-type cytokine/chemokine profiles in human PBMC cultures such as IL-1β, IL-2R, IL-8, IL-10, IL-12, IFN-α, IFN-γ, MCP-1, RANTES, MIP-1α, MIP-1β, TNF-α. | Toll-like receptor 7/8 (TLR7/8) | Toll-like receptor (TLR) | Human | PBMCs | NA | NA | NA | NA | This induces the inflammatory response. | PBMC assay | 19269175 | 2009 | NA |
| PRRID_0387 | SIMRA Compound 3 Click for more detail | NA | 5'-UGC*UGC*UUGUG-X-GUGUUC*GUC*GU-5' | 23 | Nucleic Acid | Synthetic | SIMRA compounds containing arabinonucleotides induced Th1-type cytokine/chemokine profiles in human PBMC cultures such as IL-1β, IL-2R, IL-8, IL-10, IL-12, IFN-α, IFN-γ, MCP-1, RANTES, MIP-1α, MIP-1β, TNF-α. | Toll-like receptor 7/8 (TLR7/8) | Toll-like receptor (TLR) | Human | PBMCs | NA | NA | NA | NA | This induces the inflammatory response. | PBMC assay | 19269175 | 2009 | NA |
| PRRID_0388 | SIMRA Compound 3 Click for more detail | NA | 5'-UGC*UGC*UUGUG-X-GUGUUC*GUC*GU-5' | 23 | Nucleic Acid | Synthetic | SIMRA compounds containing arabinonucleotides induces the cytokines production in human pDCs cultures such as IFN-γ, IFN-α, IL-12, TNF-α, MIP-1α, MIP-1β. | Toll-like receptor 7/8 (TLR7/8) | Toll-like receptor (TLR) | Human | pDCs | NA | NA | NA | NA | This induces the inflammatory response. | NA | 19269175 | 2009 | NA |
| PRRID_0388 | SIMRA Compound 3 Click for more detail | NA | 5'-UGC*UGC*UUGUG-X-GUGUUC*GUC*GU-5' | 23 | Nucleic Acid | Synthetic | SIMRA compounds containing arabinonucleotides induces the cytokines production in human pDCs cultures such as IFN-γ, IFN-α, IL-12, TNF-α, MIP-1α, MIP-1β. | Toll-like receptor 7/8 (TLR7/8) | Toll-like receptor (TLR) | Human | pDCs | NA | NA | NA | NA | This induces the inflammatory response. | NA | 19269175 | 2009 | NA |
| PRRID_0389 | SIMRA Compound 3 Click for more detail | NA | 5'-UGC*UGC*UUGUG-X-GUGUUC*GUC*GU-5' | 23 | Nucleic Acid | Synthetic | On stimulation, production of significant amount of IL-12, KC, and IP-10 takes place. | Toll-like receptor 7/8 (TLR7/8) | Toll-like receptor (TLR) | Mice | Macropahges | NA | NA | NA | NA | This induces the inflammatory response. | cell-based assays | 19269175 | 2009 | NA |
| PRRID_0389 | SIMRA Compound 3 Click for more detail | NA | 5'-UGC*UGC*UUGUG-X-GUGUUC*GUC*GU-5' | 23 | Nucleic Acid | Synthetic | On stimulation, production of significant amount of IL-12, KC, and IP-10 takes place. | Toll-like receptor 7/8 (TLR7/8) | Toll-like receptor (TLR) | Mice | Macropahges | NA | NA | NA | NA | This induces the inflammatory response. | cell-based assays | 19269175 | 2009 | NA |
| PRRID_0390 | SIMRA Compound 4 Click for more detail | NA | 5'-U*GCU*GCUUGUG-X-GUGUUCGU*CGU*-5' | 23 | Nucleic Acid | Synthetic | Stminulation leads to the activation of NF-kappaB, leads to the release of proinflammatory cytokines | Toll-like receptor 8 (TLR8) | Toll-like receptor (TLR) | Human | HEK293XL cells | NA | Q9NR97.fasta | Q9NR97 | 1041 | This induces the inflammatory response. | NA | 19269175 | 2009 | Pubchem Assay |
| PRRID_0390 | SIMRA Compound 4 Click for more detail | NA | 5'-U*GCU*GCUUGUG-X-GUGUUCGU*CGU*-5' | 23 | Nucleic Acid | Synthetic | Stminulation leads to the activation of NF-kappaB, leads to the release of proinflammatory cytokines | Toll-like receptor 8 (TLR8) | Toll-like receptor (TLR) | Human | HEK293XL cells | NA | Q9NR97.fasta | Q9NR97 | 1041 | This induces the inflammatory response. | NA | 19269175 | 2009 | Pubchem Assay |
| PRRID_0391 | SIMRA Compound 4 Click for more detail | NA | 5'-U*GCU*GCUUGUG-X-GUGUUCGU*CGU*-5' | 23 | Nucleic Acid | Synthetic | SIMRA compounds containing arabinonucleotides induced Th1-type cytokine/chemokine profiles in human PBMC cultures such as IL-1β, IL-2R, IL-8, IL-10, IL-12, IFN-α, IFN-γ, MCP-1, RANTES, MIP-1α, MIP-1β, TNF-α. | Toll-like receptor 8 (TLR8) | Toll-like receptor (TLR) | Human | PBMCs | NA | Q9NR97.fasta | Q9NR97 | 1041 | This induces the inflammatory response. | PBMC assay | 19269175 | 2009 | Pubchem Assay |
| PRRID_0391 | SIMRA Compound 4 Click for more detail | NA | 5'-U*GCU*GCUUGUG-X-GUGUUCGU*CGU*-5' | 23 | Nucleic Acid | Synthetic | SIMRA compounds containing arabinonucleotides induced Th1-type cytokine/chemokine profiles in human PBMC cultures such as IL-1β, IL-2R, IL-8, IL-10, IL-12, IFN-α, IFN-γ, MCP-1, RANTES, MIP-1α, MIP-1β, TNF-α. | Toll-like receptor 8 (TLR8) | Toll-like receptor (TLR) | Human | PBMCs | NA | Q9NR97.fasta | Q9NR97 | 1041 | This induces the inflammatory response. | PBMC assay | 19269175 | 2009 | Pubchem Assay |
| PRRID_0392 | SIMRA Compound 4 Click for more detail | NA | 5'-U*GCU*GCUUGUG-X-GUGUUCGU*CGU*-5' | 23 | Nucleic Acid | Synthetic | SIMRA compounds containing arabinonucleotides induces the cytokines production in human pDCs cultures such as IFN-γ, IFN-α, IL-12, TNF-α, MIP-1α, MIP-1β. | Toll-like receptor 8 (TLR8) | Toll-like receptor (TLR) | Human | pDCs | NA | Q9NR97.fasta | Q9NR97 | 1041 | This induces the inflammatory response. | NA | 19269175 | 2009 | Pubchem Assay |
| PRRID_0392 | SIMRA Compound 4 Click for more detail | NA | 5'-U*GCU*GCUUGUG-X-GUGUUCGU*CGU*-5' | 23 | Nucleic Acid | Synthetic | SIMRA compounds containing arabinonucleotides induces the cytokines production in human pDCs cultures such as IFN-γ, IFN-α, IL-12, TNF-α, MIP-1α, MIP-1β. | Toll-like receptor 8 (TLR8) | Toll-like receptor (TLR) | Human | pDCs | NA | Q9NR97.fasta | Q9NR97 | 1041 | This induces the inflammatory response. | NA | 19269175 | 2009 | Pubchem Assay |
| PRRID_0393 | SIMRA Compound 5 Click for more detail | NA | 5'-UGUUGUGUGAC-X-CAGUGUGUUGU-5' | 23 | Nucleic Acid | Synthetic | Stminulation leads to the activation of NF-kappaB, leads to the release of proinflammatory cytokines | Toll-like receptor 8 (TLR8) | Toll-like receptor (TLR) | Human | HEK293XL cells | NA | Q9NR97.fasta | Q9NR97 | 1041 | This induces the inflammatory response. | NA | 19269175 | 2009 | Pubchem Assay |
| PRRID_0393 | SIMRA Compound 5 Click for more detail | NA | 5'-UGUUGUGUGAC-X-CAGUGUGUUGU-5' | 23 | Nucleic Acid | Synthetic | Stminulation leads to the activation of NF-kappaB, leads to the release of proinflammatory cytokines | Toll-like receptor 8 (TLR8) | Toll-like receptor (TLR) | Human | HEK293XL cells | NA | Q9NR97.fasta | Q9NR97 | 1041 | This induces the inflammatory response. | NA | 19269175 | 2009 | Pubchem Assay |
| PRRID_0394 | SIMRA Compound 5 Click for more detail | NA | 5'-UGUUGUGUGAC-X-CAGUGUGUUGU-5' | 23 | Nucleic Acid | Synthetic | SIMRA compounds containing arabinonucleotides induced Th1-type cytokine/chemokine profiles in human PBMC cultures such as IL-1β, IL-2R, IL-8, IL-10, IL-12, IFN-α, IFN-γ, MCP-1, RANTES, MIP-1α, MIP-1β, TNF-α. | Toll-like receptor 8 (TLR8) | Toll-like receptor (TLR) | Human | PBMCs | NA | Q9NR97.fasta | Q9NR97 | 1041 | This induces the inflammatory response. | PBMC assay | 19269175 | 2009 | Pubchem Assay |
| PRRID_0394 | SIMRA Compound 5 Click for more detail | NA | 5'-UGUUGUGUGAC-X-CAGUGUGUUGU-5' | 23 | Nucleic Acid | Synthetic | SIMRA compounds containing arabinonucleotides induced Th1-type cytokine/chemokine profiles in human PBMC cultures such as IL-1β, IL-2R, IL-8, IL-10, IL-12, IFN-α, IFN-γ, MCP-1, RANTES, MIP-1α, MIP-1β, TNF-α. | Toll-like receptor 8 (TLR8) | Toll-like receptor (TLR) | Human | PBMCs | NA | Q9NR97.fasta | Q9NR97 | 1041 | This induces the inflammatory response. | PBMC assay | 19269175 | 2009 | Pubchem Assay |
| PRRID_0395 | SIMRA Compound 5 Click for more detail | NA | 5'-UGUUGUGUGAC-X-CAGUGUGUUGU-5' | 23 | Nucleic Acid | Synthetic | SIMRA compounds containing arabinonucleotides induces the cytokines production in human pDCs cultures such as IFN-γ, IFN-α, IL-12, TNF-α, MIP-1α, MIP-1β. | Toll-like receptor 8 (TLR8) | Toll-like receptor (TLR) | Human | pDCs | NA | Q9NR97.fasta | Q9NR97 | 1041 | This induces the inflammatory response. | NA | 19269175 | 2009 | Pubchem Assay |
| PRRID_0395 | SIMRA Compound 5 Click for more detail | NA | 5'-UGUUGUGUGAC-X-CAGUGUGUUGU-5' | 23 | Nucleic Acid | Synthetic | SIMRA compounds containing arabinonucleotides induces the cytokines production in human pDCs cultures such as IFN-γ, IFN-α, IL-12, TNF-α, MIP-1α, MIP-1β. | Toll-like receptor 8 (TLR8) | Toll-like receptor (TLR) | Human | pDCs | NA | Q9NR97.fasta | Q9NR97 | 1041 | This induces the inflammatory response. | NA | 19269175 | 2009 | Pubchem Assay |
| PRRID_0396 | SIMRA Compound 6 Click for more detail | NA | 5'-UGUUGUGUGA*C-X-CA*GUGUGUUGU-5' | 23 | Nucleic Acid | Synthetic | Stminulation leads to the activation of NF-kappaB, leads to the release of proinflammatory cytokines | Toll-like receptor 8 (TLR8) | Toll-like receptor (TLR) | Human | HEK293XL cells | NA | Q9NR97.fasta | Q9NR97 | 1041 | This induces the inflammatory response. | NA | 19269175 | 2009 | Pubchem Assay |
| PRRID_0396 | SIMRA Compound 6 Click for more detail | NA | 5'-UGUUGUGUGA*C-X-CA*GUGUGUUGU-5' | 23 | Nucleic Acid | Synthetic | Stminulation leads to the activation of NF-kappaB, leads to the release of proinflammatory cytokines | Toll-like receptor 8 (TLR8) | Toll-like receptor (TLR) | Human | HEK293XL cells | NA | Q9NR97.fasta | Q9NR97 | 1041 | This induces the inflammatory response. | NA | 19269175 | 2009 | Pubchem Assay |
| PRRID_0397 | SIMRA Compound 6 Click for more detail | NA | 5'-UGUUGUGUGA*C-X-CA*GUGUGUUGU-5' | 23 | Nucleic Acid | Synthetic | SIMRA compounds containing arabinonucleotides induced Th1-type cytokine/chemokine profiles in human PBMC cultures such as IL-1β, IL-2R, IL-8, IL-10, IL-12, IFN-α, IFN-γ, MCP-1, RANTES, MIP-1α, MIP-1β, TNF-α. | Toll-like receptor 8 (TLR8) | Toll-like receptor (TLR) | Human | PBMCs | NA | Q9NR97.fasta | Q9NR97 | 1041 | This induces the inflammatory response. | PBMC assay | 19269175 | 2009 | Pubchem Assay |
| PRRID_0397 | SIMRA Compound 6 Click for more detail | NA | 5'-UGUUGUGUGA*C-X-CA*GUGUGUUGU-5' | 23 | Nucleic Acid | Synthetic | SIMRA compounds containing arabinonucleotides induced Th1-type cytokine/chemokine profiles in human PBMC cultures such as IL-1β, IL-2R, IL-8, IL-10, IL-12, IFN-α, IFN-γ, MCP-1, RANTES, MIP-1α, MIP-1β, TNF-α. | Toll-like receptor 8 (TLR8) | Toll-like receptor (TLR) | Human | PBMCs | NA | Q9NR97.fasta | Q9NR97 | 1041 | This induces the inflammatory response. | PBMC assay | 19269175 | 2009 | Pubchem Assay |
| PRRID_0398 | SIMRA Compound 6 Click for more detail | NA | 5'-UGUUGUGUGA*C-X-CA*GUGUGUUGU-5' | 23 | Nucleic Acid | Synthetic | SIMRA compounds containing arabinonucleotides induces the cytokines production in human pDCs cultures such as IFN-γ, IFN-α, IL-12, TNF-α, MIP-1α, MIP-1β. | Toll-like receptor 8 (TLR8) | Toll-like receptor (TLR) | Human | pDCs | NA | Q9NR97.fasta | Q9NR97 | 1041 | This induces the inflammatory response. | NA | 19269175 | 2009 | Pubchem Assay |
| PRRID_0398 | SIMRA Compound 6 Click for more detail | NA | 5'-UGUUGUGUGA*C-X-CA*GUGUGUUGU-5' | 23 | Nucleic Acid | Synthetic | SIMRA compounds containing arabinonucleotides induces the cytokines production in human pDCs cultures such as IFN-γ, IFN-α, IL-12, TNF-α, MIP-1α, MIP-1β. | Toll-like receptor 8 (TLR8) | Toll-like receptor (TLR) | Human | pDCs | NA | Q9NR97.fasta | Q9NR97 | 1041 | This induces the inflammatory response. | NA | 19269175 | 2009 | Pubchem Assay |
| PRRID_0399 | Streptococcus gordonii Click for more detail | S. gordonii (Bacteria) | NA | NA | Whole organism | Natural | Stimulation elicits the production of tumour necrosis factor (TNF), interleukin (IL)-6, IL-10 and IL-12p70. | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Mice (Murine) | Bone-marrow derived Dendritic cells | LRR | Q9QUN7.fasta | Q9QUN7 | 784 | This activation can be attributed to multiple immunostimulatory components present within S. gordonii bacterial cells. | ELISA | 19284500 | 2009 | Pubchem Assay |
| PRRID_0399 | Streptococcus gordonii Click for more detail | S. gordonii (Bacteria) | NA | NA | Whole organism | Natural | Stimulation elicits the production of tumour necrosis factor (TNF), interleukin (IL)-6, IL-10 and IL-12p70. | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Mice (Murine) | Bone-marrow derived Dendritic cells | LRR | Q9QUN7.fasta | Q9QUN7 | 784 | This activation can be attributed to multiple immunostimulatory components present within S. gordonii bacterial cells. | ELISA | 19284500 | 2009 | Pubchem Assay |
| PRRID_0400 | Viral Genome Click for more detail | Rabies virus (virus) | NA | NA | Nucleic Acid | Natural | Rabies genome is a potent activator of TLR3 | Toll-like receptor 3 (TLR3) | Toll-like receptor (TLR) | Human | Neuronal cells | NA | O15455.fasta | O15455 | 904 | TLR3 is involved in the spatial arrangement of rabies virus–induced NBs and viral replication. | NA | 19247444 | 2009 | Pubchem Assay |
| PRRID_0400 | Viral Genome Click for more detail | Rabies virus (virus) | NA | NA | Nucleic Acid | Natural | Rabies genome is a potent activator of TLR3 | Toll-like receptor 3 (TLR3) | Toll-like receptor (TLR) | Human | Neuronal cells | NA | O15455.fasta | O15455 | 904 | TLR3 is involved in the spatial arrangement of rabies virus–induced NBs and viral replication. | NA | 19247444 | 2009 | Pubchem Assay |
| PRRID_0401 | 1,3 beta glucan Click for more detail | Sparassis crispa (fungi) | C(C1C(C(C(C(O1)OC2C(OC(C(C2O)O)OC3C(OC(C(C3O)O)O)CO)CO)O)O)O)O | NA | Carbohydrate | Natural | Anti-tumour properties | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Mice | dendritic cells and macrophages | Leucine-rich Repeat (LRR) Domain | Q9QUK6.fasta | Q9QUK6 | 835 | It can induce the phenotypic and functional maturation of DCs. | NA | 20699131 | 2010 | Pubchem Assay |
| PRRID_0401 | 1,3 beta glucan Click for more detail | Sparassis crispa (fungi) | C(C1C(C(C(C(O1)OC2C(OC(C(C2O)O)OC3C(OC(C(C3O)O)O)CO)CO)O)O)O)O | NA | Carbohydrate | Natural | Anti-tumour properties | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Mice | dendritic cells and macrophages | Leucine-rich Repeat (LRR) Domain | Q9QUK6.fasta | Q9QUK6 | 835 | It can induce the phenotypic and functional maturation of DCs. | NA | 20699131 | 2010 | Pubchem Assay |
| PRRID_0404 | A46R Click for more detail | Vaccinia(virus) | MAFDISVNASKTINALVYFSTQQNKLVIRNEVNDTHYTVEFDRDKVVDTFISYNRHNDTIEIRGVLPEETNIGCAVNTPVSMTYLYNKYSFKLILAEYIRHRNTISGNIYSALMTLDDLAIKQYGDIDLLFNEKLKVDSDSGLFDFVNFVKDMICCDSRIVVALSSLVSKHWELTNKKYRCMALANIYLIVFQYLSYLDYDTIYVSIYAGTLRA | 214 | Protein | Natural | Suppress NF-κB activation (Bind to MyD88, TRAM, and TRIF) | Toll-like receptor 1/2 (TLR1/2) | Toll-like receptor (TLR) | Human | NA | Leucine-rich Repeat (LRR) Domain | NA | NA | NA | Suppress cytokine production | NA | 20672047 | 2010 | NA |
| PRRID_0404 | A46R Click for more detail | Vaccinia(virus) | MAFDISVNASKTINALVYFSTQQNKLVIRNEVNDTHYTVEFDRDKVVDTFISYNRHNDTIEIRGVLPEETNIGCAVNTPVSMTYLYNKYSFKLILAEYIRHRNTISGNIYSALMTLDDLAIKQYGDIDLLFNEKLKVDSDSGLFDFVNFVKDMICCDSRIVVALSSLVSKHWELTNKKYRCMALANIYLIVFQYLSYLDYDTIYVSIYAGTLRA | 214 | Protein | Natural | Suppress NF-κB activation (Bind to MyD88, TRAM, and TRIF) | Toll-like receptor 1/2 (TLR1/2) | Toll-like receptor (TLR) | Human | NA | Leucine-rich Repeat (LRR) Domain | NA | NA | NA | Suppress cytokine production | NA | 20672047 | 2010 | NA |
| PRRID_0405 | A52R Click for more detail | Vaccinia(virus) | MDIKIDISISGDKFTVTTRRENEERKKYLPLQKEKTTDVIKPDYLEYDDLLDRDEMSTILEEYFMYRGLLGLRIKYGRLFNEIKKFDNDAEEQFGTIEELKQKLRLNSEEGADNFIDYIKVQKQDIVKLTVYDCISMIGLCACVVDVWRNEKLFSRWKYCLRAIKLFINDHMLDKIKSILQNRLVYVEMS | 190 | Protein | Natural | Suppress NF-κB activation (Bind to IRAK2) and | Toll-like receptor 1/2 (TLR1/2) | Toll-like receptor (TLR) | Human | NA | Leucine-rich Repeat (LRR) Domain | NA | NA | NA | Suppress cytokine production | NA | 20672047 | 2010 | NA |
| PRRID_0405 | A52R Click for more detail | Vaccinia(virus) | MDIKIDISISGDKFTVTTRRENEERKKYLPLQKEKTTDVIKPDYLEYDDLLDRDEMSTILEEYFMYRGLLGLRIKYGRLFNEIKKFDNDAEEQFGTIEELKQKLRLNSEEGADNFIDYIKVQKQDIVKLTVYDCISMIGLCACVVDVWRNEKLFSRWKYCLRAIKLFINDHMLDKIKSILQNRLVYVEMS | 190 | Protein | Natural | Suppress NF-κB activation (Bind to IRAK2) and | Toll-like receptor 1/2 (TLR1/2) | Toll-like receptor (TLR) | Human | NA | Leucine-rich Repeat (LRR) Domain | NA | NA | NA | Suppress cytokine production | NA | 20672047 | 2010 | NA |
| PRRID_0406 | A52R Click for more detail | Vaccinia(virus) | MDIKIDISISGDKFTVTTRRENEERKKYLPLQKEKTTDVIKPDYLEYDDLLDRDEMSTILEEYFMYRGLLGLRIKYGRLFNEIKKFDNDAEEQFGTIEELKQKLRLNSEEGADNFIDYIKVQKQDIVKLTVYDCISMIGLCACVVDVWRNEKLFSRWKYCLRAIKLFINDHMLDKIKSILQNRLVYVEMS | 190 | Protein | Natural | Activate p38 MAPK and JNK (Bind to TRAF6) | Toll-like receptor 1/2 (TLR1/2) | Toll-like receptor (TLR) | Human | NA | Leucine-rich Repeat (LRR) Domain | NA | NA | NA | Induce IL-10 production | NA | 20672047 | 2010 | NA |
| PRRID_0406 | A52R Click for more detail | Vaccinia(virus) | MDIKIDISISGDKFTVTTRRENEERKKYLPLQKEKTTDVIKPDYLEYDDLLDRDEMSTILEEYFMYRGLLGLRIKYGRLFNEIKKFDNDAEEQFGTIEELKQKLRLNSEEGADNFIDYIKVQKQDIVKLTVYDCISMIGLCACVVDVWRNEKLFSRWKYCLRAIKLFINDHMLDKIKSILQNRLVYVEMS | 190 | Protein | Natural | Activate p38 MAPK and JNK (Bind to TRAF6) | Toll-like receptor 1/2 (TLR1/2) | Toll-like receptor (TLR) | Human | NA | Leucine-rich Repeat (LRR) Domain | NA | NA | NA | Induce IL-10 production | NA | 20672047 | 2010 | NA |
| PRRID_0407 | acylated LprA Click for more detail | M. tuberculosis (Bacteria) | NA | NA | Lipoprotein | Natural | Induced IL-8 secretion | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Human | NA | Leucine-rich Repeat (LRR) Domain | O60603.fasta | O60603 | 784 | Phagocytosis | ELISA | 20694006 | 2010 | Pubchem Assay |
| PRRID_0407 | acylated LprA Click for more detail | M. tuberculosis (Bacteria) | NA | NA | Lipoprotein | Natural | Induced IL-8 secretion | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Human | NA | Leucine-rich Repeat (LRR) Domain | O60603.fasta | O60603 | 784 | Phagocytosis | ELISA | 20694006 | 2010 | Pubchem Assay |
| PRRID_0408 | acylated LprG Click for more detail | M. tuberculosis (Bacteria) | NA | NA | Lipoprotein | Natural | Delivery of glycolipds to TLR2 | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Human | NA | Leucine-rich Repeat (LRR) Domain | O60603.fasta | O60603 | 784 | Phagocytosis | ELISA | 20694006 | 2010 | Pubchem Assay |
| PRRID_0408 | acylated LprG Click for more detail | M. tuberculosis (Bacteria) | NA | NA | Lipoprotein | Natural | Delivery of glycolipds to TLR2 | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Human | NA | Leucine-rich Repeat (LRR) Domain | O60603.fasta | O60603 | 784 | Phagocytosis | ELISA | 20694006 | 2010 | Pubchem Assay |
| PRRID_0412 | Arabinosylated lipoarabinomannan (Ara-LAM) Click for more detail | Mycobacterium tuberculosis (Bacteria) | NA | NA | Glycolipid | Natural | It triggers downstream signalling via MyD88, lead to the ativation of NF- | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Leishmania donovani infected Mice | macropahge | Leucine-rich Repeat (LRR) Domain | Q9QUN7.fasta | Q9QUN7 | 784 | The immunoprophylactic role played by Ara-LAM in conferring protection against visceral leishmaniasis | EMSA and ELISA | 20500089 | 2010 | Pubchem Assay |
| PRRID_0412 | Arabinosylated lipoarabinomannan (Ara-LAM) Click for more detail | Mycobacterium tuberculosis (Bacteria) | NA | NA | Glycolipid | Natural | It triggers downstream signalling via MyD88, lead to the ativation of NF- | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Leishmania donovani infected Mice | macropahge | Leucine-rich Repeat (LRR) Domain | Q9QUN7.fasta | Q9QUN7 | 784 | The immunoprophylactic role played by Ara-LAM in conferring protection against visceral leishmaniasis | EMSA and ELISA | 20500089 | 2010 | Pubchem Assay |
| PRRID_0414 | AtPep1 Click for more detail | Arabidopsis thaliana(plant) | ATKVKAKQRGKEKVSSGRPGQHN | 23 | Peptide | Natural | It triggers a receptor-dependent transient depolarization through activation of plasma membrane anion channels. | PEPR1 | Toll-like receptor (TLR) | Arabidopsis | Plasma membrane | LRR | NA | NA | NA | It caused seedling growth inhibition of arabidopsis thaliana | Growth inhibition assay | 20200150 | 2010 | NA |
| PRRID_0414 | AtPep1 Click for more detail | Arabidopsis thaliana(plant) | ATKVKAKQRGKEKVSSGRPGQHN | 23 | Peptide | Natural | It triggers a receptor-dependent transient depolarization through activation of plasma membrane anion channels. | PEPR1 | Toll-like receptor (TLR) | Arabidopsis | Plasma membrane | LRR | NA | NA | NA | It caused seedling growth inhibition of arabidopsis thaliana | Growth inhibition assay | 20200150 | 2010 | NA |
| PRRID_0415 | AtPep2 Click for more detail | NA | DNKAKSKKRDKEKPSSGRPGQTNSVPNAAIQVYKED | 36 | Peptide | Synthetic | It increase cytosolic calcium and activate chloride channels followed by membrane depolarization in a strictly receptor-dependent manner. | PEPR1 | Toll-like receptor (TLR) | Arabidopsis | Plasma membrane | LRR | NA | NA | NA | It caused seedling growth inhibition of arabidopsis thaliana | Growth inhibition assay | 20200150 | 2010 | NA |
| PRRID_0415 | AtPep2 Click for more detail | NA | DNKAKSKKRDKEKPSSGRPGQTNSVPNAAIQVYKED | 36 | Peptide | Synthetic | It increase cytosolic calcium and activate chloride channels followed by membrane depolarization in a strictly receptor-dependent manner. | PEPR1 | Toll-like receptor (TLR) | Arabidopsis | Plasma membrane | LRR | NA | NA | NA | It caused seedling growth inhibition of arabidopsis thaliana | Growth inhibition assay | 20200150 | 2010 | NA |
| PRRID_0416 | AtPep3 Click for more detail | NA | EIKARGKNKTKPTPSSGKGGKHN | 23 | Peptide | Synthetic | It increase cytosolic calcium and activate chloride channels followed by membrane depolarization in a strictly receptor-dependent manner. | PEPR1 | Toll-like receptor (TLR) | Arabidopsis | Plasma membrane | LRR | NA | NA | NA | It caused seedling growth inhibition of arabidopsis thaliana | Growth inhibition assay | 20200150 | 2010 | NA |
| PRRID_0416 | AtPep3 Click for more detail | NA | EIKARGKNKTKPTPSSGKGGKHN | 23 | Peptide | Synthetic | It increase cytosolic calcium and activate chloride channels followed by membrane depolarization in a strictly receptor-dependent manner. | PEPR1 | Toll-like receptor (TLR) | Arabidopsis | Plasma membrane | LRR | NA | NA | NA | It caused seedling growth inhibition of arabidopsis thaliana | Growth inhibition assay | 20200150 | 2010 | NA |
| PRRID_0417 | AtPep4 Click for more detail | NA | NA | NA | Peptide | Synthetic | It increase cytosolic calcium and activate chloride channels followed by membrane depolarization in a strictly receptor-dependent manner. | PEPR1 | Toll-like receptor (TLR) | Arabidopsis | Plasma membrane | LRR | NA | NA | NA | It caused seedling growth inhibition of arabidopsis thaliana | Growth inhibition assay | 20200150 | 2010 | NA |
| PRRID_0417 | AtPep4 Click for more detail | NA | NA | NA | Peptide | Synthetic | It increase cytosolic calcium and activate chloride channels followed by membrane depolarization in a strictly receptor-dependent manner. | PEPR1 | Toll-like receptor (TLR) | Arabidopsis | Plasma membrane | LRR | NA | NA | NA | It caused seedling growth inhibition of arabidopsis thaliana | Growth inhibition assay | 20200150 | 2010 | NA |
| PRRID_0418 | AtPep5 Click for more detail | NA | NA | NA | Peptide | Synthetic | It increase cytosolic calcium and activate chloride channels followed by membrane depolarization in a strictly receptor-dependent manner. | PEPR1 | Toll-like receptor (TLR) | Arabidopsis | Plasma membrane | LRR | NA | NA | NA | It caused seedling growth inhibition of arabidopsis thaliana | Growth inhibition assay | 20200150 | 2010 | NA |
| PRRID_0418 | AtPep5 Click for more detail | NA | NA | NA | Peptide | Synthetic | It increase cytosolic calcium and activate chloride channels followed by membrane depolarization in a strictly receptor-dependent manner. | PEPR1 | Toll-like receptor (TLR) | Arabidopsis | Plasma membrane | LRR | NA | NA | NA | It caused seedling growth inhibition of arabidopsis thaliana | Growth inhibition assay | 20200150 | 2010 | NA |
| PRRID_0419 | AtPep6 Click for more detail | NA | NA | NA | Peptide | Synthetic | It increase cytosolic calcium and activate chloride channels followed by membrane depolarization in a strictly receptor-dependent manner. | PEPR1 | Toll-like receptor (TLR) | Arabidopsis | Plasma membrane | LRR | NA | NA | NA | It caused seedling growth inhibition of arabidopsis thaliana | Growth inhibition assay | 20200150 | 2010 | NA |
| PRRID_0419 | AtPep6 Click for more detail | NA | NA | NA | Peptide | Synthetic | It increase cytosolic calcium and activate chloride channels followed by membrane depolarization in a strictly receptor-dependent manner. | PEPR1 | Toll-like receptor (TLR) | Arabidopsis | Plasma membrane | LRR | NA | NA | NA | It caused seedling growth inhibition of arabidopsis thaliana | Growth inhibition assay | 20200150 | 2010 | NA |
| PRRID_0421 | Bacterial Antigen Click for more detail | B. abortus 544(Bacteria) | NA | NA | NA | Natural | It's binding leads to the bacterial uptake via phagocytosis | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Mice | Trophoblast giant cells | Leucine-rich Repeat (LRR) Domain | Q9QUN7.fasta | Q9QUN7 | 784 | It helps in placental defense system by extracellular bacterial antigen uptake via phagocytosis. | Bacterial Infection assay | 20471681 | 2010 | Pubchem Assay |
| PRRID_0421 | Bacterial Antigen Click for more detail | B. abortus 544(Bacteria) | NA | NA | NA | Natural | It's binding leads to the bacterial uptake via phagocytosis | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Mice | Trophoblast giant cells | Leucine-rich Repeat (LRR) Domain | Q9QUN7.fasta | Q9QUN7 | 784 | It helps in placental defense system by extracellular bacterial antigen uptake via phagocytosis. | Bacterial Infection assay | 20471681 | 2010 | Pubchem Assay |
| PRRID_0423 | Bacterial Antigen Click for more detail | L. monocytogenes (Bacteria) | NA | NA | NA | Natural | It's binding leads to the bacterial uptake via phagocytosis | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Mice | Trophoblast giant cells | Leucine-rich Repeat (LRR) Domain | Q9QUN7.fasta | Q9QUN7 | 784 | It helps in placental defense system by extracellular bacterial antigen uptake via phagocytosis. | Bacterial Infection assay | 20471681 | 2010 | Pubchem Assay |
| PRRID_0423 | Bacterial Antigen Click for more detail | L. monocytogenes (Bacteria) | NA | NA | NA | Natural | It's binding leads to the bacterial uptake via phagocytosis | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Mice | Trophoblast giant cells | Leucine-rich Repeat (LRR) Domain | Q9QUN7.fasta | Q9QUN7 | 784 | It helps in placental defense system by extracellular bacterial antigen uptake via phagocytosis. | Bacterial Infection assay | 20471681 | 2010 | Pubchem Assay |
| PRRID_0426 | Bacterial DNA Click for more detail | Porphyromonas gingivalis and Tannerella forsythia (Bacteria) | NA | NA | Nucleic Acid | Natural | It induces the release of IL-8 , IL-1beta, IL-6 TNF-alpha, and NF- | Toll-like receptor 9 (TLR9) | Toll-like receptor (TLR) | Human | Monocytic cells (THP-1 cells) | LRR | Q9NR96.fasta | Q9NR96 | 1032 | Immune responses triggered by periodontal bacterial nucleic acids mediated by inducing proinflammatory cytokine production through the TLR9 signaling pathway. | ELISA | 20331800 | 2010 | Pubchem Assay |
| PRRID_0426 | Bacterial DNA Click for more detail | Porphyromonas gingivalis and Tannerella forsythia (Bacteria) | NA | NA | Nucleic Acid | Natural | It induces the release of IL-8 , IL-1beta, IL-6 TNF-alpha, and NF- | Toll-like receptor 9 (TLR9) | Toll-like receptor (TLR) | Human | Monocytic cells (THP-1 cells) | LRR | Q9NR96.fasta | Q9NR96 | 1032 | Immune responses triggered by periodontal bacterial nucleic acids mediated by inducing proinflammatory cytokine production through the TLR9 signaling pathway. | ELISA | 20331800 | 2010 | Pubchem Assay |
| PRRID_0429 | BV-nucleic acid Click for more detail | Baculovirus(virus) | NA | NA | Nucleic Acid | Natural | It leads to increased expression of cytokine IL-12 p40 | Toll-like receptor 21 (TLR21) | Toll-like receptor (TLR) | Chicken | Macrophage-like cell line (HD11) | Leucine-rich Repeat (LRR) Domain | NA | NA | NA | This results into the inflammatory response, which leads to clearance of pathogen | NA | 20471186 | 2010 | NA |
| PRRID_0429 | BV-nucleic acid Click for more detail | Baculovirus(virus) | NA | NA | Nucleic Acid | Natural | It leads to increased expression of cytokine IL-12 p40 | Toll-like receptor 21 (TLR21) | Toll-like receptor (TLR) | Chicken | Macrophage-like cell line (HD11) | Leucine-rich Repeat (LRR) Domain | NA | NA | NA | This results into the inflammatory response, which leads to clearance of pathogen | NA | 20471186 | 2010 | NA |
| PRRID_0434 | Cinnamaldehyde Click for more detail | China Medicine (Group) Shanghai Chemical Reagent(others) | C1=CC=C(C=C1)C=CC=O | NA | Drug | Synthetic | It inhibits the NF- | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | coxsackievirus B3 (CVB3)-induced viral myocarditis (VMC) | Heart | Leucine-rich Repeat (LRR) Domain | NA | NA | NA | It has antiviral effects on VMC through its metabolite, cinnamic acid. | NA | 20460981 | 2010 | NA |
| PRRID_0434 | Cinnamaldehyde Click for more detail | China Medicine (Group) Shanghai Chemical Reagent(others) | C1=CC=C(C=C1)C=CC=O | NA | Drug | Synthetic | It inhibits the NF- | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | coxsackievirus B3 (CVB3)-induced viral myocarditis (VMC) | Heart | Leucine-rich Repeat (LRR) Domain | NA | NA | NA | It has antiviral effects on VMC through its metabolite, cinnamic acid. | NA | 20460981 | 2010 | NA |
| PRRID_0435 | CL097 Click for more detail | derivative of the imidazoquinoline compound R848(others) | CCOCC1=NC2=C(N1)C(=NC3=CC=CC=C32)N | NA | Nucleic Acid | Synthetic | The binding induces the production of IL-6, IL-10, TNF-‚ç∫ and IL-23 | Toll-like receptor 7/8 (TLR7/8) | Toll-like receptor (TLR) | Human | Lamina propria DCs obtained from the human GI tract | Leucine-rich Repeat (LRR) Domain | NA | NA | NA | It induces intestinal inflammation and potentially alter the homeostatic response to commensal flora | NA | 20483758 | 2010 | NA |
| PRRID_0435 | CL097 Click for more detail | derivative of the imidazoquinoline compound R848(others) | CCOCC1=NC2=C(N1)C(=NC3=CC=CC=C32)N | NA | Nucleic Acid | Synthetic | The binding induces the production of IL-6, IL-10, TNF-‚ç∫ and IL-23 | Toll-like receptor 7/8 (TLR7/8) | Toll-like receptor (TLR) | Human | Lamina propria DCs obtained from the human GI tract | Leucine-rich Repeat (LRR) Domain | NA | NA | NA | It induces intestinal inflammation and potentially alter the homeostatic response to commensal flora | NA | 20483758 | 2010 | NA |
| PRRID_0436 | Compound A Click for more detail | NA | NA | NA | Chemical Compunds | Synthetic | it induces IL-6 production in murine macrophage | Toll-like receptor 2/1 (TLR2/1) | Toll-like receptor (TLR) | Human | Peripheral blood monocytes and macrophages | Leucine-rich Repeat (LRR) Domain | NA | NA | NA | It casues inflammation in the respective cells | ELISA | 20504771 | 2010 | NA |
| PRRID_0436 | Compound A Click for more detail | NA | NA | NA | Chemical Compunds | Synthetic | it induces IL-6 production in murine macrophage | Toll-like receptor 2/1 (TLR2/1) | Toll-like receptor (TLR) | Human | Peripheral blood monocytes and macrophages | Leucine-rich Repeat (LRR) Domain | NA | NA | NA | It casues inflammation in the respective cells | ELISA | 20504771 | 2010 | NA |
| PRRID_0437 | Compound B Click for more detail | 3-carboxylbenzothiophene linked via a carbonothioylamino bridge to an anilino group (others) | NA | NA | Chemical Compunds | Synthetic | it induces TNF-‚ç∫ production from human monocytes | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Human | Peripheral blood monocytes and macrophages | Leucine-rich Repeat (LRR) Domain | O60603.fasta | O60603 | 784 | It casues inflammation in the respective cells | ELISA | 20504771 | 2010 | Pubchem Assay |
| PRRID_0437 | Compound B Click for more detail | 3-carboxylbenzothiophene linked via a carbonothioylamino bridge to an anilino group (others) | NA | NA | Chemical Compunds | Synthetic | it induces TNF-‚ç∫ production from human monocytes | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Human | Peripheral blood monocytes and macrophages | Leucine-rich Repeat (LRR) Domain | O60603.fasta | O60603 | 784 | It casues inflammation in the respective cells | ELISA | 20504771 | 2010 | Pubchem Assay |
| PRRID_0438 | Compound C Click for more detail | 3-carboxylbenzothiophene linked via a carbonothioylamino bridge to an anilino group (others) | NA | NA | Chemical Compunds | Synthetic | it induces TNF-‚ç∫ production from human monocytes | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Human | Peripheral blood monocytes and macrophages | Leucine-rich Repeat (LRR) Domain | O60603.fasta | O60603 | 784 | It casues inflammation in the respective cells | ELISA | 20504771 | 2010 | Pubchem Assay |
| PRRID_0438 | Compound C Click for more detail | 3-carboxylbenzothiophene linked via a carbonothioylamino bridge to an anilino group (others) | NA | NA | Chemical Compunds | Synthetic | it induces TNF-‚ç∫ production from human monocytes | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Human | Peripheral blood monocytes and macrophages | Leucine-rich Repeat (LRR) Domain | O60603.fasta | O60603 | 784 | It casues inflammation in the respective cells | ELISA | 20504771 | 2010 | Pubchem Assay |
| PRRID_0439 | Compound E Click for more detail | N1-(benzyl)-N2-(phenyl)-N2-(sulfonyl)glycinamide (others) | NA | NA | Chemical Compunds | Synthetic | it induces TNF-‚ç∫ production from human monocytes | Toll-like receptor 2/6 (TLR2/6) | Toll-like receptor (TLR) | Human | Peripheral blood monocytes and macrophages | Leucine-rich Repeat (LRR) Domain | NA | NA | NA | It casues inflammation in the respective cells | ELISA | 20504771 | 2010 | NA |
| PRRID_0439 | Compound E Click for more detail | N1-(benzyl)-N2-(phenyl)-N2-(sulfonyl)glycinamide (others) | NA | NA | Chemical Compunds | Synthetic | it induces TNF-‚ç∫ production from human monocytes | Toll-like receptor 2/6 (TLR2/6) | Toll-like receptor (TLR) | Human | Peripheral blood monocytes and macrophages | Leucine-rich Repeat (LRR) Domain | NA | NA | NA | It casues inflammation in the respective cells | ELISA | 20504771 | 2010 | NA |
| PRRID_0440 | Compound F Click for more detail | N1-(benzyl)-N2-(phenyl)-N2-(sulfonyl)glycinamide (others) | NA | NA | Chemical Compunds | Synthetic | it induces TNF-‚ç∫ production from human monocytes | Toll-like receptor 2/6 (TLR2/6) | Toll-like receptor (TLR) | Human | Peripheral blood monocytes and macrophages | Leucine-rich Repeat (LRR) Domain | NA | NA | NA | It casues inflammation in the respective cells | ELISA | 20504771 | 2010 | NA |
| PRRID_0440 | Compound F Click for more detail | N1-(benzyl)-N2-(phenyl)-N2-(sulfonyl)glycinamide (others) | NA | NA | Chemical Compunds | Synthetic | it induces TNF-‚ç∫ production from human monocytes | Toll-like receptor 2/6 (TLR2/6) | Toll-like receptor (TLR) | Human | Peripheral blood monocytes and macrophages | Leucine-rich Repeat (LRR) Domain | NA | NA | NA | It casues inflammation in the respective cells | ELISA | 20504771 | 2010 | NA |
| PRRID_0441 | core protein Click for more detail | Hepatitis C Virus (virus) | MSTNPKPQRKTKRNTNRRPMDVKFPGGGQIVGGVYLLPRRGPRLGVRATRKTSERSQPRGRRQPIPKARRTEGRSWAQPGYPWPLYGNEGCGWAGWLLSPRGSRXSWGPNDPRXRSRNLGKVIDTLTCGFADLMGYIPLVGAPVGGVARALAHGVRAVEDGINYATGNLPGCSFSIFLLALLSCLTVPTSAVNYRNASGIYHITNDCPNASIVYETENHILHLPGCVPCVRTGNQSRCWVALTPTVASPYAGAPLEPLRRHVDLMVGAATMCSALYIGDLCGGLFLVGQMFTFQPRRHWTTQDCNCSIYTGHITGHRMA | 319 | Protein | Natural | Induce cytokines responses through nuclear translocation of nuclear factor-kB (NF-kB) subunits | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Human | Antigen presenting cells | Leucine-rich Repeat (LRR) Domain | O60603.fasta | O60603 | 784 | It reduces the IL-6 production in these cells | NA | 20677943 | 2010 | Pubchem Assay |
| PRRID_0441 | core protein Click for more detail | Hepatitis C Virus (virus) | MSTNPKPQRKTKRNTNRRPMDVKFPGGGQIVGGVYLLPRRGPRLGVRATRKTSERSQPRGRRQPIPKARRTEGRSWAQPGYPWPLYGNEGCGWAGWLLSPRGSRXSWGPNDPRXRSRNLGKVIDTLTCGFADLMGYIPLVGAPVGGVARALAHGVRAVEDGINYATGNLPGCSFSIFLLALLSCLTVPTSAVNYRNASGIYHITNDCPNASIVYETENHILHLPGCVPCVRTGNQSRCWVALTPTVASPYAGAPLEPLRRHVDLMVGAATMCSALYIGDLCGGLFLVGQMFTFQPRRHWTTQDCNCSIYTGHITGHRMA | 319 | Protein | Natural | Induce cytokines responses through nuclear translocation of nuclear factor-kB (NF-kB) subunits | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Human | Antigen presenting cells | Leucine-rich Repeat (LRR) Domain | O60603.fasta | O60603 | 784 | It reduces the IL-6 production in these cells | NA | 20677943 | 2010 | Pubchem Assay |
| PRRID_0442 | core protein Click for more detail | Hepatitis C Virus (virus) | MSTNPKPQRKTKRNTNRRPMDVKFPGGGQIVGGVYLLPRRGPRLGVRATRKTSERSQPRGRRQPIPKARRTEGRSWAQPGYPWPLYGNEGCGWAGWLLSPRGSRXSWGPNDPRXRSRNLGKVIDTLTCGFADLMGYIPLVGAPVGGVARALAHGVRAVEDGINYATGNLPGCSFSIFLLALLSCLTVPTSAVNYRNASGIYHITNDCPNASIVYETENHILHLPGCVPCVRTGNQSRCWVALTPTVASPYAGAPLEPLRRHVDLMVGAATMCSALYIGDLCGGLFLVGQMFTFQPRRHWTTQDCNCSIYTGHITGHRMA | 319 | Protein | Natural | Activate MAP kinase pathway, NF-κB, and AP-1 | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Human | monocytes and Kupffer cells | Leucine-rich Repeat (LRR) Domain | O60603.fasta | O60603 | 784 | Dysfunction of pDCs by enhanced production of IL-10 and TNF- α | NA | 20672047 | 2010 | Pubchem Assay |
| PRRID_0442 | core protein Click for more detail | Hepatitis C Virus (virus) | MSTNPKPQRKTKRNTNRRPMDVKFPGGGQIVGGVYLLPRRGPRLGVRATRKTSERSQPRGRRQPIPKARRTEGRSWAQPGYPWPLYGNEGCGWAGWLLSPRGSRXSWGPNDPRXRSRNLGKVIDTLTCGFADLMGYIPLVGAPVGGVARALAHGVRAVEDGINYATGNLPGCSFSIFLLALLSCLTVPTSAVNYRNASGIYHITNDCPNASIVYETENHILHLPGCVPCVRTGNQSRCWVALTPTVASPYAGAPLEPLRRHVDLMVGAATMCSALYIGDLCGGLFLVGQMFTFQPRRHWTTQDCNCSIYTGHITGHRMA | 319 | Protein | Natural | Activate MAP kinase pathway, NF-κB, and AP-1 | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Human | monocytes and Kupffer cells | Leucine-rich Repeat (LRR) Domain | O60603.fasta | O60603 | 784 | Dysfunction of pDCs by enhanced production of IL-10 and TNF- α | NA | 20672047 | 2010 | Pubchem Assay |
| PRRID_0443 | CpG DNA Click for more detail | Virus | NA | NA | Nucleic Acid | Natural | Activates NF-KB and MAPK which lead to the production of cytokines as TNF and other proinflammatory proteins | Toll-like receptor 9 (TLR9) | Toll-like receptor (TLR) | Human | NA | Leucine-rich Repeat (LRR) Domain | Q9NR96.fasta | Q9NR96 | 1032 | It coauses the inflammation | NA | 20740341 | 2010 | Pubchem Assay |
| PRRID_0443 | CpG DNA Click for more detail | Virus | NA | NA | Nucleic Acid | Natural | Activates NF-KB and MAPK which lead to the production of cytokines as TNF and other proinflammatory proteins | Toll-like receptor 9 (TLR9) | Toll-like receptor (TLR) | Human | NA | Leucine-rich Repeat (LRR) Domain | Q9NR96.fasta | Q9NR96 | 1032 | It coauses the inflammation | NA | 20740341 | 2010 | Pubchem Assay |
| PRRID_0444 | CpG DNA motifs Click for more detail | Virus, Bacteria | NA | NA | Nucleic Acid | Natural | NA | Toll-like receptor 21 (TLR21) | Toll-like receptor (TLR) | Chicken | NA | Leucine-rich Repeat (LRR) Domain | NA | NA | NA | Inflammation | NA | 20692289 | 2010 | NA |
| PRRID_0444 | CpG DNA motifs Click for more detail | Virus, Bacteria | NA | NA | Nucleic Acid | Natural | NA | Toll-like receptor 21 (TLR21) | Toll-like receptor (TLR) | Chicken | NA | Leucine-rich Repeat (LRR) Domain | NA | NA | NA | Inflammation | NA | 20692289 | 2010 | NA |
| PRRID_0445 | CpG motif Click for more detail | Bacteria | NA | NA | Nucleic Acid | Natural | Activates NF-KB and MAPK which lead to the production of cytokines as TNF and other proinflammatory proteins | Toll-like receptor 9 (TLR9) | Toll-like receptor (TLR) | Human | NA | Leucine-rich Repeat (LRR) Domain | Q9NR96.fasta | Q9NR96 | 1032 | It coauses the inflammation | NA | 20740341 | 2010 | Pubchem Assay |
| PRRID_0445 | CpG motif Click for more detail | Bacteria | NA | NA | Nucleic Acid | Natural | Activates NF-KB and MAPK which lead to the production of cytokines as TNF and other proinflammatory proteins | Toll-like receptor 9 (TLR9) | Toll-like receptor (TLR) | Human | NA | Leucine-rich Repeat (LRR) Domain | Q9NR96.fasta | Q9NR96 | 1032 | It coauses the inflammation | NA | 20740341 | 2010 | Pubchem Assay |
| PRRID_0446 | CpG motif Click for more detail | HSV-1 (virus) | NA | NA | Nucleic Acid | Natural | It's binding leads to the release of the arra of cytokines | Toll-like receptor 9 (TLR9) | Toll-like receptor (TLR) | Human | DCs | Leucine-rich Repeat (LRR) Domain | Q9NR96.fasta | Q9NR96 | 1032 | It recognize and raise the inflammatory response | NA | 20713890 | 2010 | Pubchem Assay |
| PRRID_0446 | CpG motif Click for more detail | HSV-1 (virus) | NA | NA | Nucleic Acid | Natural | It's binding leads to the release of the arra of cytokines | Toll-like receptor 9 (TLR9) | Toll-like receptor (TLR) | Human | DCs | Leucine-rich Repeat (LRR) Domain | Q9NR96.fasta | Q9NR96 | 1032 | It recognize and raise the inflammatory response | NA | 20713890 | 2010 | Pubchem Assay |
| PRRID_0447 | CpG motif Click for more detail | HSV-2 (virus) | NA | NA | Nucleic Acid | Natural | It's binding leads to the release of the arra of cytokines | Toll-like receptor 10 (TLR10) | Toll-like receptor (TLR) | Human | DCs | Leucine-rich Repeat (LRR) Domain | Q9BXR5.fasta | Q9BXR5 | 811 | It recognize and raise the inflammatory response | NA | 20713890 | 2010 | Pubchem Assay |
| PRRID_0447 | CpG motif Click for more detail | HSV-2 (virus) | NA | NA | Nucleic Acid | Natural | It's binding leads to the release of the arra of cytokines | Toll-like receptor 10 (TLR10) | Toll-like receptor (TLR) | Human | DCs | Leucine-rich Repeat (LRR) Domain | Q9BXR5.fasta | Q9BXR5 | 811 | It recognize and raise the inflammatory response | NA | 20713890 | 2010 | Pubchem Assay |
| PRRID_0448 | CpG motif Click for more detail | murine CMV (virus) | NA | NA | Nucleic Acid | Natural | It's binding leads to the release of the arra of cytokines | Toll-like receptor 10 (TLR10) | Toll-like receptor (TLR) | Human | DCs | Leucine-rich Repeat (LRR) Domain | NA | NA | NA | It recognize and raise the inflammatory response | NA | 20713890 | 2010 | NA |
| PRRID_0448 | CpG motif Click for more detail | murine CMV (virus) | NA | NA | Nucleic Acid | Natural | It's binding leads to the release of the arra of cytokines | Toll-like receptor 10 (TLR10) | Toll-like receptor (TLR) | Human | DCs | Leucine-rich Repeat (LRR) Domain | NA | NA | NA | It recognize and raise the inflammatory response | NA | 20713890 | 2010 | NA |