| Primary information |
|---|
| PRRID | PRRID_0441 |
| Ligand Name | core protein |
| Source | Hepatitis C Virus (virus) |
| Sequence of ligand | MSTNPKPQRKTKRNTNRRPMDVKFPGGGQIVGGVYLLPRRGPRLGVRATRKTSERSQPRGRRQPIPKARRTEGRSWAQPGYPWPLYGNEGCGWAGWLLSPRGSRXSWGPNDPRXRSRNLGKVIDTLTCGFADLMGYIPLVGAPVGGVARALAHGVRAVEDGINYATGNLPGCSFSIFLLALLSCLTVPTSAVNYRNASGIYHITNDCPNASIVYETENHILHLPGCVPCVRTGNQSRCWVALTPTVASPYAGAPLEPLRRHVDLMVGAATMCSALYIGDLCGGLFLVGQMFTFQPRRHWTTQDCNCSIYTGHITGHRMA |
| Length | 319 |
| Type | Protein |
| Occurence | Natural |
| Role of Ligand | Induce cytokines responses through nuclear translocation of nuclear factor-kB (NF-kB) subunits |
| Name of receptor | Toll-like receptor 2 (TLR2) |
| Type of receptor | Toll-like receptor (TLR) |
| Source | Human |
| Localization | Antigen presenting cells |
| Domain | Leucine-rich Repeat (LRR) Domain |
| Sequence of Receptor | O60603.fasta |
| Swiss prot ID | O60603 |
| Length Of Receptor | 784 |
| Function | It reduces the IL-6 production in these cells |
| Assay used | NA |
| PMID | 20677943 |
| Year of Publication | 2010 |
| Pubchem assay | Pubchem Assay |
| Primary information |
|---|
| PRRID | PRRID_0441 |
| Ligand Name | core protein |
| Source | Hepatitis C Virus (virus) |
| Sequence of ligand | MSTNPKPQRKTKRNTNRRPMDVKFPGGGQIVGGVYLLPRRGPRLGVRATRKTSERSQPRGRRQPIPKARRTEGRSWAQPGYPWPLYGNEGCGWAGWLLSPRGSRXSWGPNDPRXRSRNLGKVIDTLTCGFADLMGYIPLVGAPVGGVARALAHGVRAVEDGINYATGNLPGCSFSIFLLALLSCLTVPTSAVNYRNASGIYHITNDCPNASIVYETENHILHLPGCVPCVRTGNQSRCWVALTPTVASPYAGAPLEPLRRHVDLMVGAATMCSALYIGDLCGGLFLVGQMFTFQPRRHWTTQDCNCSIYTGHITGHRMA |
| Length | 319 |
| Type | Protein |
| Occurence | Natural |
| Role of Ligand | Induce cytokines responses through nuclear translocation of nuclear factor-kB (NF-kB) subunits |
| Name of receptor | Toll-like receptor 2 (TLR2) |
| Type of receptor | Toll-like receptor (TLR) |
| Source | Human |
| Localization | Antigen presenting cells |
| Domain | Leucine-rich Repeat (LRR) Domain |
| Sequence of Receptor | O60603.fasta |
| Swiss prot ID | O60603 |
| Length Of Receptor | 784 |
| Function | It reduces the IL-6 production in these cells |
| Assay used | NA |
| PMID | 20677943 |
| Year of Publication | 2010 |
| Pubchem assay | Pubchem Assay |