Browse result page of PRRDB 2.0

PRRID	Name of Ligand	Source of ligand	Sequence of Ligand	Length of Ligand	Type of Ligand	Occurence	Role of Ligand	Name of Receptor	Type of Reeptor	Source of the Receptor	Localization	Domain	Sequence of Receptor	Swiss prot ID	Length of receptor	Function of Receptor	Assay used	PMID	Year of publication	Pubchem assay
PRRID_0565	HpaA Click for more detail	H. pylori (Bacteria)	NA	NA	Lipoprotein	Natural	It activates the TLR2, which leads to the secretion of IL-12 and IFN-	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	Natural Killer cells	LRR	O60603.fasta	O60603	784	It has a immunostimulatory role	ELISA	20130107	2010	Pubchem Assay
PRRID_0565	HpaA Click for more detail	H. pylori (Bacteria)	NA	NA	Lipoprotein	Natural	It activates the TLR2, which leads to the secretion of IL-12 and IFN-	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	Natural Killer cells	LRR	O60603.fasta	O60603	784	It has a immunostimulatory role	ELISA	20130107	2010	Pubchem Assay
PRRID_0646	Lipoprotein Click for more detail	Staphylococcus epidermis & aureus (Bacteria)	NA	NA	Lipoprotein	Natural	TLR-2 mediated by the NF-kB pathway in septic arthritic chondrocytes and cytokine production	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Septic Chondrocytes from homo sapiens	NA	Leucine-rich Repeat (LRR) Domain	O60603.fasta	O60603	784	Immunostimulation and inflammation	NA	20740673	2010	Pubchem Assay
PRRID_0646	Lipoprotein Click for more detail	Staphylococcus epidermis & aureus (Bacteria)	NA	NA	Lipoprotein	Natural	TLR-2 mediated by the NF-kB pathway in septic arthritic chondrocytes and cytokine production	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Septic Chondrocytes from homo sapiens	NA	Leucine-rich Repeat (LRR) Domain	O60603.fasta	O60603	784	Immunostimulation and inflammation	NA	20740673	2010	Pubchem Assay
PRRID_0647	Lipoprotein Click for more detail	M. tuberculosis (Bacteria)	NA	NA	Lipoprotein	Natural	Lipoprotein binds to the TLR2 and activates the downstream cascades	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	NA	Leucine-rich Repeat (LRR) Domain	O60603.fasta	O60603	784	It has the role in the inflammation.	NA	20729207	2010	Pubchem Assay
PRRID_0647	Lipoprotein Click for more detail	M. tuberculosis (Bacteria)	NA	NA	Lipoprotein	Natural	Lipoprotein binds to the TLR2 and activates the downstream cascades	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	NA	Leucine-rich Repeat (LRR) Domain	O60603.fasta	O60603	784	It has the role in the inflammation.	NA	20729207	2010	Pubchem Assay
PRRID_0649	Lipoprotein Click for more detail	M. tuberculosis (Bacteria)	NA	NA	Lipoprotein	Natural	lipoprotein and lipoarabinomannan are the poteny activators of the TLR2	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	DNA samples from peripheral blood of TB patients	NA	Leucine-rich Repeat (LRR) Domain	O60603.fasta	O60603	784	Immunostimulation and inflammation	NA	20797905	2010	Pubchem Assay
PRRID_0649	Lipoprotein Click for more detail	M. tuberculosis (Bacteria)	NA	NA	Lipoprotein	Natural	lipoprotein and lipoarabinomannan are the poteny activators of the TLR2	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	DNA samples from peripheral blood of TB patients	NA	Leucine-rich Repeat (LRR) Domain	O60603.fasta	O60603	784	Immunostimulation and inflammation	NA	20797905	2010	Pubchem Assay
PRRID_0664	LpqH Click for more detail	Mtb H37Ra (Bacteria)	MKRGLTVAVAGAAILVAGLSGCSSNKSTTGSGETTTAAGTTASPGAASGPKVVIDGKDQNVTGSVVCTTAAGNVNIAIGGAATGIAAVLTDGNPPEVKSVGLGNVNGVTLGYTSGTGQGNASATKDGSHYKITGTATGVDMANPMSPVNKSFEIEVTCS	159	Lipoprotein	Natural	It activate antibacterial autophagy through vitamin D receptor signalling activation and cathelicidin induction.	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	Primary Monocytes	Leucine-rich Repeat (LRR) Domain	O60603.fasta	O60603	784	It leads to the clearance of the pathogen via autophagy	NA	20560977	2010	Pubchem Assay
PRRID_0664	LpqH Click for more detail	Mtb H37Ra (Bacteria)	MKRGLTVAVAGAAILVAGLSGCSSNKSTTGSGETTTAAGTTASPGAASGPKVVIDGKDQNVTGSVVCTTAAGNVNIAIGGAATGIAAVLTDGNPPEVKSVGLGNVNGVTLGYTSGTGQGNASATKDGSHYKITGTATGVDMANPMSPVNKSFEIEVTCS	159	Lipoprotein	Natural	It activate antibacterial autophagy through vitamin D receptor signalling activation and cathelicidin induction.	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	Primary Monocytes	Leucine-rich Repeat (LRR) Domain	O60603.fasta	O60603	784	It leads to the clearance of the pathogen via autophagy	NA	20560977	2010	Pubchem Assay
PRRID_0665	LpqH Click for more detail	Mtb H37Ra (Bacteria)	MKRGLTVAVAGAAILVAGLSGCSSNKSTTGSGETTTAAGTTASPGAASGPKVVIDGKDQNVTGSVVCTTAAGNVNIAIGGAATGIAAVLTDGNPPEVKSVGLGNVNGVTLGYTSGTGQGNASATKDGSHYKITGTATGVDMANPMSPVNKSFEIEVTCS	159	Lipoprotein	Natural	It activate antibacterial autophagy through vitamin D receptor signalling activation and cathelicidin induction.	Toll-like receptor 1 (TLR1)	Toll-like receptor (TLR)	Human	Primary Monocytes	Leucine-rich Repeat (LRR) Domain	Q15399.fasta	Q15399	786	It leads to the clearance of the pathogen via autophagy	NA	20560977	2010	Pubchem Assay
PRRID_0665	LpqH Click for more detail	Mtb H37Ra (Bacteria)	MKRGLTVAVAGAAILVAGLSGCSSNKSTTGSGETTTAAGTTASPGAASGPKVVIDGKDQNVTGSVVCTTAAGNVNIAIGGAATGIAAVLTDGNPPEVKSVGLGNVNGVTLGYTSGTGQGNASATKDGSHYKITGTATGVDMANPMSPVNKSFEIEVTCS	159	Lipoprotein	Natural	It activate antibacterial autophagy through vitamin D receptor signalling activation and cathelicidin induction.	Toll-like receptor 1 (TLR1)	Toll-like receptor (TLR)	Human	Primary Monocytes	Leucine-rich Repeat (LRR) Domain	Q15399.fasta	Q15399	786	It leads to the clearance of the pathogen via autophagy	NA	20560977	2010	Pubchem Assay
PRRID_0666	LpqH Click for more detail	Mtb H37Ra (Bacteria)	MKRGLTVAVAGAAILVAGLSGCSSNKSTTGSGETTTAAGTTASPGAASGPKVVIDGKDQNVTGSVVCTTAAGNVNIAIGGAATGIAAVLTDGNPPEVKSVGLGNVNGVTLGYTSGTGQGNASATKDGSHYKITGTATGVDMANPMSPVNKSFEIEVTCS	159	Lipoprotein	Natural	It activate antibacterial autophagy through vitamin D receptor signalling activation and cathelicidin induction.	cluster of differentiation 14 (CD14)	Pattern recognition receptor (PRR)	Human	Primary Monocytes	Leucine-rich Repeat (LRR) Domain	P08571.fasta	P08571	375	It leads to the clearance of the pathogen via autophagy	NA	20560977	2010	Pubchem Assay
PRRID_0666	LpqH Click for more detail	Mtb H37Ra (Bacteria)	MKRGLTVAVAGAAILVAGLSGCSSNKSTTGSGETTTAAGTTASPGAASGPKVVIDGKDQNVTGSVVCTTAAGNVNIAIGGAATGIAAVLTDGNPPEVKSVGLGNVNGVTLGYTSGTGQGNASATKDGSHYKITGTATGVDMANPMSPVNKSFEIEVTCS	159	Lipoprotein	Natural	It activate antibacterial autophagy through vitamin D receptor signalling activation and cathelicidin induction.	cluster of differentiation 14 (CD14)	Pattern recognition receptor (PRR)	Human	Primary Monocytes	Leucine-rich Repeat (LRR) Domain	P08571.fasta	P08571	375	It leads to the clearance of the pathogen via autophagy	NA	20560977	2010	Pubchem Assay
PRRID_0667	LprG (Rv1411c) Click for more detail	Mtb H37Rv (Bacteria)	MRTPRRHCRRIAVLAAVSIAATVVAGCSSGSKPSGGPLPDAKPLVEEATAQTKALKSAHMVLTVNGKIPGLSLKTLSGDLTTNPTAATGNVKLTLGGSDIDADFVVFDGILYATLTPNQWSDFGPAADIYDPAQVLNPDTGLANVLANFADAKAEGRDTINGQNTIRISGKVSAQAVNQIAPPFNATQPVPATVWIQETGDHQLAQAQLDRGSGNSVQMTLSKWGEKVQVTKPPVS	236	Lipoprotein	Natural	Delivery of glycolipds to TLR2	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	C57BL/6 Mouse pulmonary aerosol Infection models	NA	Leucine-rich Repeat (LRR) Domain	Q9QUN7.fasta	Q9QUN7	784	Reduces virulence of Mtb	ELISA	20694006	2010	Pubchem Assay
PRRID_0667	LprG (Rv1411c) Click for more detail	Mtb H37Rv (Bacteria)	MRTPRRHCRRIAVLAAVSIAATVVAGCSSGSKPSGGPLPDAKPLVEEATAQTKALKSAHMVLTVNGKIPGLSLKTLSGDLTTNPTAATGNVKLTLGGSDIDADFVVFDGILYATLTPNQWSDFGPAADIYDPAQVLNPDTGLANVLANFADAKAEGRDTINGQNTIRISGKVSAQAVNQIAPPFNATQPVPATVWIQETGDHQLAQAQLDRGSGNSVQMTLSKWGEKVQVTKPPVS	236	Lipoprotein	Natural	Delivery of glycolipds to TLR2	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	C57BL/6 Mouse pulmonary aerosol Infection models	NA	Leucine-rich Repeat (LRR) Domain	Q9QUN7.fasta	Q9QUN7	784	Reduces virulence of Mtb	ELISA	20694006	2010	Pubchem Assay
PRRID_0681	mmLDL Click for more detail	Native Human LDL (others)	CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1	NA	Lipoprotein	Synthetic	The binding of mmLDL, induces the production of TNF- and increasing the expression of TLR2 and TLR4	cluster of differentiation 14 (CD14)	Pattern recognition receptor (PRR)	Human	Monocytes and Macrophages	NA	P08571.fasta	P08571	375	It triggering an inflammatory response characterized by induction of TNF-‚ç∫ production and upregulation of TLR2 and TLR4 expression in human monocytes and macrophages.	ELISA	20472010	2010	Pubchem Assay
PRRID_0681	mmLDL Click for more detail	Native Human LDL (others)	CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1	NA	Lipoprotein	Synthetic	The binding of mmLDL, induces the production of TNF- and increasing the expression of TLR2 and TLR4	cluster of differentiation 14 (CD14)	Pattern recognition receptor (PRR)	Human	Monocytes and Macrophages	NA	P08571.fasta	P08571	375	It triggering an inflammatory response characterized by induction of TNF-‚ç∫ production and upregulation of TLR2 and TLR4 expression in human monocytes and macrophages.	ELISA	20472010	2010	Pubchem Assay
PRRID_0682	mmLDL Click for more detail	Native Human LDL (others)	CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1	NA	Lipoprotein	Synthetic	The binding of mmLDL, induces the production of TNF-and increasing the expression of TLR2 and TLR5	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	Monocytes and Macrophages	Leucine-rich Repeat (LRR) Domain	O60603.fasta	O60603	784	It triggering an inflammatory response characterized by induction of TNF-‚ç∫ production and upregulation of TLR2 and TLR4 expression in human monocytes and macrophages.	ELISA	20472010	2010	Pubchem Assay
PRRID_0682	mmLDL Click for more detail	Native Human LDL (others)	CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1	NA	Lipoprotein	Synthetic	The binding of mmLDL, induces the production of TNF-and increasing the expression of TLR2 and TLR5	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	Monocytes and Macrophages	Leucine-rich Repeat (LRR) Domain	O60603.fasta	O60603	784	It triggering an inflammatory response characterized by induction of TNF-‚ç∫ production and upregulation of TLR2 and TLR4 expression in human monocytes and macrophages.	ELISA	20472010	2010	Pubchem Assay
PRRID_0683	mmLDL Click for more detail	Native Human LDL (others)	CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1	NA	Lipoprotein	Synthetic	The binding of mmLDL, induces the production of TNF- and increasing the expression of TLR2 and TLR6	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Human	Monocytes and Macrophages	Leucine-rich Repeat (LRR) Domain	O00206.fasta	O00206	839	It triggering an inflammatory response characterized by induction of TNF-‚ç∫ production and upregulation of TLR2 and TLR4 expression in human monocytes and macrophages.	ELISA	20472010	2010	Pubchem Assay
PRRID_0683	mmLDL Click for more detail	Native Human LDL (others)	CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1	NA	Lipoprotein	Synthetic	The binding of mmLDL, induces the production of TNF- and increasing the expression of TLR2 and TLR6	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Human	Monocytes and Macrophages	Leucine-rich Repeat (LRR) Domain	O00206.fasta	O00206	839	It triggering an inflammatory response characterized by induction of TNF-‚ç∫ production and upregulation of TLR2 and TLR4 expression in human monocytes and macrophages.	ELISA	20472010	2010	Pubchem Assay
PRRID_0802	SitC-His Click for more detail	S. aureus (Bacteria)	NA	NA	Lipoprotein	Natural	Induce IL-6 and TNF-‚ç∫ release	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	Monocytes	Leucine-rich Repeat (LRR) Domain	O60603.fasta	O60603	784	NA	NA	20679445	2010	Pubchem Assay
PRRID_0802	SitC-His Click for more detail	S. aureus (Bacteria)	NA	NA	Lipoprotein	Natural	Induce IL-6 and TNF-‚ç∫ release	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	Monocytes	Leucine-rich Repeat (LRR) Domain	O60603.fasta	O60603	784	NA	NA	20679445	2010	Pubchem Assay
PRRID_0803	SitC-His Click for more detail	S. aureus (Bacteria)	NA	NA	Lipoprotein	Natural	Activation of NF-	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	HEK293	Leucine-rich Repeat (LRR) Domain	O60603.fasta	O60603	784	NA	NA	20679445	2010	Pubchem Assay
PRRID_0803	SitC-His Click for more detail	S. aureus (Bacteria)	NA	NA	Lipoprotein	Natural	Activation of NF-	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	HEK293	Leucine-rich Repeat (LRR) Domain	O60603.fasta	O60603	784	NA	NA	20679445	2010	Pubchem Assay
PRRID_0817	Triacetylated lipoproteins Click for more detail	M. tuberculosis (Bacteria)	CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1	NA	Lipoprotein	Natural	On binding to the receptor it, activates the heterocomplex of TLR2/6 and secretion of cytokines takes place	Toll-like receptor 2/1 (TLR2/1)	Toll-like receptor (TLR)	DNA samples from peripheral blood of TB patients	NA	Leucine-rich Repeat (LRR) Domain	NA	NA	NA	Immunostimulation and inflammation	NA	20797905	2010	NA
PRRID_0817	Triacetylated lipoproteins Click for more detail	M. tuberculosis (Bacteria)	CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1	NA	Lipoprotein	Natural	On binding to the receptor it, activates the heterocomplex of TLR2/6 and secretion of cytokines takes place	Toll-like receptor 2/1 (TLR2/1)	Toll-like receptor (TLR)	DNA samples from peripheral blood of TB patients	NA	Leucine-rich Repeat (LRR) Domain	NA	NA	NA	Immunostimulation and inflammation	NA	20797905	2010	NA
PRRID_0945	Pam3CSK4 Click for more detail	Bacteria	CCCCCCCCCCCCCCCC(=O)NC(CSCC(COC(=O)CCCCCCCCCCCCCCC)OC(=O)CCCCCCCCCCCCCCC)C(=O)NC(CO)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)O	NA	Lipoprotein	Synthetic	Mimics the acylated amino terminus of bacterial LPs and is a potent activator of the proinflammatory transcription factor NF-Œ∫B.	Toll-like receptor (TLR1/Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice	NA	intracellular TIR domains	NA	NA	NA	TLR2 is involved in the specific recognition of a wide range of ligands, either as a homodimer or as a heterodimer with TLR1 or TLR6	NA	21959264	2011	NA
PRRID_0945	Pam3CSK4 Click for more detail	Bacteria	CCCCCCCCCCCCCCCC(=O)NC(CSCC(COC(=O)CCCCCCCCCCCCCCC)OC(=O)CCCCCCCCCCCCCCC)C(=O)NC(CO)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)O	NA	Lipoprotein	Synthetic	Mimics the acylated amino terminus of bacterial LPs and is a potent activator of the proinflammatory transcription factor NF-Œ∫B.	Toll-like receptor (TLR1/Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice	NA	intracellular TIR domains	NA	NA	NA	TLR2 is involved in the specific recognition of a wide range of ligands, either as a homodimer or as a heterodimer with TLR1 or TLR6	NA	21959264	2011	NA
PRRID_1050	FSL-1 Click for more detail	synthetic lipoprotein (others)	CCCCCCCCCCCCCCCC(=O)OCC(CSC[C@@H](C(=O)NCC(=O)N[C@@H](CC(=O)O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC2=CN=CN2)C(=O)N3CCC[C@H]3C(=O)N[C@@H](CCCCN)C(=ON[C@@H(COC(=O)N[C@@H](CC4=CC=CC=C4)C(=O)O)N)OC(=O)CCCCCCCCCCCCCCC	NA	Lipoprotein	Synthetic	mimic parts of bacterial lipoproteins	Toll-like receptor 6 /2 (TLR6/2)	Toll-like receptor (TLR)	Human	HEK293 cells	NA	NA	NA	NA	fundamental role in pathogen recognition and activation of innate immunity.	NF-	24098508	2013	NA
PRRID_1050	FSL-1 Click for more detail	synthetic lipoprotein (others)	CCCCCCCCCCCCCCCC(=O)OCC(CSC[C@@H](C(=O)NCC(=O)N[C@@H](CC(=O)O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC2=CN=CN2)C(=O)N3CCC[C@H]3C(=O)N[C@@H](CCCCN)C(=ON[C@@H(COC(=O)N[C@@H](CC4=CC=CC=C4)C(=O)O)N)OC(=O)CCCCCCCCCCCCCCC	NA	Lipoprotein	Synthetic	mimic parts of bacterial lipoproteins	Toll-like receptor 6 /2 (TLR6/2)	Toll-like receptor (TLR)	Human	HEK293 cells	NA	NA	NA	NA	fundamental role in pathogen recognition and activation of innate immunity.	NF-	24098508	2013	NA
PRRID_1113	Pam3CSK4 Click for more detail	synthetic tripalmitoylated lipopeptide (others)	CCCCCCCCCCCCCCCC(=O)NC(CSCC(COC(=O)CCCCCCCCCCCCCCC)OC(=O)CCCCCCCCCCCCCCC)C(=O)NC(CO)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)O	NA	Lipoprotein	Synthetic	triacylated lipopeptide potent activator of the proinflammatory transcription factor NF-Œ∫B.¬†	Toll-like receptor 1/2 (TLR1/2)	Toll-like receptor (TLR)	Human	HEK293 cells	NA	NA	NA	NA	significant role in the pathogenesis of severe inflammatory responses	NF-	24098508	2013	NA
PRRID_1113	Pam3CSK4 Click for more detail	synthetic tripalmitoylated lipopeptide (others)	CCCCCCCCCCCCCCCC(=O)NC(CSCC(COC(=O)CCCCCCCCCCCCCCC)OC(=O)CCCCCCCCCCCCCCC)C(=O)NC(CO)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)O	NA	Lipoprotein	Synthetic	triacylated lipopeptide potent activator of the proinflammatory transcription factor NF-Œ∫B.¬†	Toll-like receptor 1/2 (TLR1/2)	Toll-like receptor (TLR)	Human	HEK293 cells	NA	NA	NA	NA	significant role in the pathogenesis of severe inflammatory responses	NF-	24098508	2013	NA
PRRID_1114	Pam3CysK Click for more detail	Bacteria	CCCCCCCCCCCCCCCC(=O)NC(CSCC(COC(=O)CCCCCCCCCCCCCCC)OC(=O)CCCCCCCCCCCCCCC)C(=O)O	NA	Lipoprotein	Synthetic	triacylated lipopeptide potent activator of the proinflammatory transcription factor NF-Œ∫B.¬†	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	TRIF mutant (C57BL/6J-Ticam1Lps2) mice	bone marrow-derived macrophage (BMDM) culture	Toll/IL-1R (TIR) domain	Q9QUN7.fasta	Q9QUN7	784	TLR2 is involved in the specific recognition of a wide range of ligands, either as a homodimer or as a heterodimer with TLR1 or TLR6.	Quantitative Real Time PCR, Cell Viability Assays, Immunoblot and Immunoprecipitations	24019532	2013	Pubchem_assay
PRRID_1114	Pam3CysK Click for more detail	Bacteria	CCCCCCCCCCCCCCCC(=O)NC(CSCC(COC(=O)CCCCCCCCCCCCCCC)OC(=O)CCCCCCCCCCCCCCC)C(=O)O	NA	Lipoprotein	Synthetic	triacylated lipopeptide potent activator of the proinflammatory transcription factor NF-Œ∫B.¬†	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	TRIF mutant (C57BL/6J-Ticam1Lps2) mice	bone marrow-derived macrophage (BMDM) culture	Toll/IL-1R (TIR) domain	Q9QUN7.fasta	Q9QUN7	784	TLR2 is involved in the specific recognition of a wide range of ligands, either as a homodimer or as a heterodimer with TLR1 or TLR6.	Quantitative Real Time PCR, Cell Viability Assays, Immunoblot and Immunoprecipitations	24019532	2013	Pubchem_assay
PRRID_1298	FSL-1 Click for more detail	Mycoplasma salivarium (Bacteria)	CCCCCCCCCCCCCCCC(=O)OCC(CSC[C@@H](C(=O)NCC(=O)N[C@@H](CC(=O)O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC2=CN=CN2)C(=O)N3CCC[C@H]3C(=O)N[C@@H](CCCCN)C(=ON[C@@H(COC(=O)N[C@@H](CC4=CC=CC=C4)C(=O)O)N)OC(=O)CCCCCCCCCCCCCCC	NA	Lipoprotein	Synthetic	NA	Toll-like receptor 6 /2 (TLR6/2)	Toll-like receptor (TLR)	Human	mast cells	cell surface	NA	NA	NA	fundamental role in pathogen recognition and activation of innate immunity.	Real-time PCR	24818634	2014	NA
PRRID_1298	FSL-1 Click for more detail	Mycoplasma salivarium (Bacteria)	CCCCCCCCCCCCCCCC(=O)OCC(CSC[C@@H](C(=O)NCC(=O)N[C@@H](CC(=O)O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC2=CN=CN2)C(=O)N3CCC[C@H]3C(=O)N[C@@H](CCCCN)C(=ON[C@@H(COC(=O)N[C@@H](CC4=CC=CC=C4)C(=O)O)N)OC(=O)CCCCCCCCCCCCCCC	NA	Lipoprotein	Synthetic	NA	Toll-like receptor 6 /2 (TLR6/2)	Toll-like receptor (TLR)	Human	mast cells	cell surface	NA	NA	NA	fundamental role in pathogen recognition and activation of innate immunity.	Real-time PCR	24818634	2014	NA
PRRID_1299	FSL-1 Click for more detail	Mycoplasma salivarium (Bacteria)	CCCCCCCCCCCCCCCC(=O)OCC(CSC[C@@H](C(=O)NCC(=O)N[C@@H](CC(=O)O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC2=CN=CN2)C(=O)N3CCC[C@H]3C(=O)N[C@@H](CCCCN)C(=ON[C@@H(COC(=O)N[C@@H](CC4=CC=CC=C4)C(=O)O)N)OC(=O)CCCCCCCCCCCCCCC	NA	Lipoprotein	Synthetic	NA	Toll-like receptor 2/6 (TLR2/6)	Toll-like receptor (TLR)	European and African Children	NA	MyD88	NA	NA	NA	fundamental role in pathogen recognition and activation of innate immunity.	ELISA	24743542	2014	NA
PRRID_1299	FSL-1 Click for more detail	Mycoplasma salivarium (Bacteria)	CCCCCCCCCCCCCCCC(=O)OCC(CSC[C@@H](C(=O)NCC(=O)N[C@@H](CC(=O)O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC2=CN=CN2)C(=O)N3CCC[C@H]3C(=O)N[C@@H](CCCCN)C(=ON[C@@H(COC(=O)N[C@@H](CC4=CC=CC=C4)C(=O)O)N)OC(=O)CCCCCCCCCCCCCCC	NA	Lipoprotein	Synthetic	NA	Toll-like receptor 2/6 (TLR2/6)	Toll-like receptor (TLR)	European and African Children	NA	MyD88	NA	NA	NA	fundamental role in pathogen recognition and activation of innate immunity.	ELISA	24743542	2014	NA
PRRID_1300	FSL-1 Click for more detail	Bacteria	CCCCCCCCCCCCCCCC(=O)OCC(CSC[C@@H](C(=O)NCC(=O)N[C@@H](CC(=O)O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC2=CN=CN2)C(=O)N3CCC[C@H]3C(=O)N[C@@H](CCCCN)C(=ON[C@@H(COC(=O)N[C@@H](CC4=CC=CC=C4)C(=O)O)N)OC(=O)CCCCCCCCCCCCCCC	NA	Lipoprotein	Synthetic	mimic parts of bacterial lipoproteins	Toll-like receptor 2/6 (TLR2/6)	Toll-like receptor (TLR)	Human	mast cells	NA	NA	NA	NA	fundamental role in pathogen recognition and activation of innate immunity.	Real-time PCR	24736205	2014	NA
PRRID_1300	FSL-1 Click for more detail	Bacteria	CCCCCCCCCCCCCCCC(=O)OCC(CSC[C@@H](C(=O)NCC(=O)N[C@@H](CC(=O)O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC2=CN=CN2)C(=O)N3CCC[C@H]3C(=O)N[C@@H](CCCCN)C(=ON[C@@H(COC(=O)N[C@@H](CC4=CC=CC=C4)C(=O)O)N)OC(=O)CCCCCCCCCCCCCCC	NA	Lipoprotein	Synthetic	mimic parts of bacterial lipoproteins	Toll-like receptor 2/6 (TLR2/6)	Toll-like receptor (TLR)	Human	mast cells	NA	NA	NA	NA	fundamental role in pathogen recognition and activation of innate immunity.	Real-time PCR	24736205	2014	NA
PRRID_1499	N-palmitoyl-S-[2,3-bis(palmitoyloxy)-propyl]-(R)-cysteinyl-(lysyl)3-lysine (PAM3CSK4) Click for more detail	Bacteria	CCCCCCCCCCCCCCCC(=O)NC(CSCC(COC(=O)CCCCCCCCCCCCCCC)OC(=O)CCCCCCCCCCCCCCC)C(=O)NC(CO)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)O	NA	Lipoprotein	Synthetic	Mimics the acylated amino terminus of bacterial LPs and is a potent activator of the proinflammatory transcription factor NF-Œ∫B.	Toll-like receptor (TLR1/Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	nasal mucosa Mesenchymal stromal cells (nmMSCs) inferior nasal concha of healthy individuals	cell surface	NA	NA	NA	TLR2 is involved in the specific recognition of a wide range of ligands, either as a homodimer or as a heterodimer with TLR1 or TLR6.	ELISA and Immunofluoroscence assay	24830384	2014	NA
PRRID_1499	N-palmitoyl-S-[2,3-bis(palmitoyloxy)-propyl]-(R)-cysteinyl-(lysyl)3-lysine (PAM3CSK4) Click for more detail	Bacteria	CCCCCCCCCCCCCCCC(=O)NC(CSCC(COC(=O)CCCCCCCCCCCCCCC)OC(=O)CCCCCCCCCCCCCCC)C(=O)NC(CO)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)O	NA	Lipoprotein	Synthetic	Mimics the acylated amino terminus of bacterial LPs and is a potent activator of the proinflammatory transcription factor NF-Œ∫B.	Toll-like receptor (TLR1/Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	nasal mucosa Mesenchymal stromal cells (nmMSCs) inferior nasal concha of healthy individuals	cell surface	NA	NA	NA	TLR2 is involved in the specific recognition of a wide range of ligands, either as a homodimer or as a heterodimer with TLR1 or TLR6.	ELISA and Immunofluoroscence assay	24830384	2014	NA
PRRID_1521	Pam3 Click for more detail	Bacteria	NA	NA	Lipoprotein	Synthetic	triacylated lipopeptide potent activator of the proinflammatory transcription factor NF-Œ∫B.	Toll-like receptor 2/1 (TLR2/1)	Toll-like receptor (TLR)	European and African Children	NA	MyD88	NA	NA	NA	TLR2 is involved in the specific recognition of a wide range of ligands, either as a homodimer or as a heterodimer with TLR1 or TLR6.	ELISA	24743542	2014	NA
PRRID_1521	Pam3 Click for more detail	Bacteria	NA	NA	Lipoprotein	Synthetic	triacylated lipopeptide potent activator of the proinflammatory transcription factor NF-Œ∫B.	Toll-like receptor 2/1 (TLR2/1)	Toll-like receptor (TLR)	European and African Children	NA	MyD88	NA	NA	NA	TLR2 is involved in the specific recognition of a wide range of ligands, either as a homodimer or as a heterodimer with TLR1 or TLR6.	ELISA	24743542	2014	NA
PRRID_1523	Pam3CSK4 Click for more detail	Bacteria	CCCCCCCCCCCCCCCC(=O)NC(CSCC(COC(=O)CCCCCCCCCCCCCCC)OC(=O)CCCCCCCCCCCCCCC)C(=O)NC(CO)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)O	NA	Lipoprotein	Synthetic	Mimics the acylated amino terminus of bacterial LPs and is a potent activator of the proinflammatory transcription factor NF-Œ∫B.	Toll-like receptor (TLR1/Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	monocyte/macrophages, DCs and B-lymphocytes	Cell Surface (Exogenous)	NA	NA	NA	TLR2 is involved in the specific recognition of a wide range of ligands, either as a homodimer or as a heterodimer with TLR1 or TLR6.	NA	24830024	2014	NA
PRRID_1523	Pam3CSK4 Click for more detail	Bacteria	CCCCCCCCCCCCCCCC(=O)NC(CSCC(COC(=O)CCCCCCCCCCCCCCC)OC(=O)CCCCCCCCCCCCCCC)C(=O)NC(CO)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)O	NA	Lipoprotein	Synthetic	Mimics the acylated amino terminus of bacterial LPs and is a potent activator of the proinflammatory transcription factor NF-Œ∫B.	Toll-like receptor (TLR1/Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	monocyte/macrophages, DCs and B-lymphocytes	Cell Surface (Exogenous)	NA	NA	NA	TLR2 is involved in the specific recognition of a wide range of ligands, either as a homodimer or as a heterodimer with TLR1 or TLR6.	NA	24830024	2014	NA
PRRID_1524	Pam3CSK4 Click for more detail	Bacteria	CCCCCCCCCCCCCCCC(=O)NC(CSCC(COC(=O)CCCCCCCCCCCCCCC)OC(=O)CCCCCCCCCCCCCCC)C(=O)NC(CO)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)O	NA	Lipoprotein	Synthetic	Mimics the acylated amino terminus of bacterial LPs and is a potent activator of the proinflammatory transcription factor NF-Œ∫B.	Toll-like receptor (TLR1/Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice	monocyte/macrophages, DCs and B-lymphocytes	Cell Surface (Exogenous)	NA	NA	NA	TLR2 is involved in the specific recognition of a wide range of ligands, either as a homodimer or as a heterodimer with TLR1 or TLR6.	NA	24830024	2014	NA
PRRID_1524	Pam3CSK4 Click for more detail	Bacteria	CCCCCCCCCCCCCCCC(=O)NC(CSCC(COC(=O)CCCCCCCCCCCCCCC)OC(=O)CCCCCCCCCCCCCCC)C(=O)NC(CO)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)O	NA	Lipoprotein	Synthetic	Mimics the acylated amino terminus of bacterial LPs and is a potent activator of the proinflammatory transcription factor NF-Œ∫B.	Toll-like receptor (TLR1/Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice	monocyte/macrophages, DCs and B-lymphocytes	Cell Surface (Exogenous)	NA	NA	NA	TLR2 is involved in the specific recognition of a wide range of ligands, either as a homodimer or as a heterodimer with TLR1 or TLR6.	NA	24830024	2014	NA
PRRID_1526	Pam3CSK4 Click for more detail	Bacteria	CCCCCCCCCCCCCCCC(=O)NC(CSCC(COC(=O)CCCCCCCCCCCCCCC)OC(=O)CCCCCCCCCCCCCCC)C(=O)NC(CO)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)O	NA	Lipoprotein	Synthetic	increases the immunogenicity of B- cell lymphoma cells and alters their trafficking pattern when combined with the genotoxic anticancer drug 1-b-D-arabinofuranosylcytosine.	Toll-like receptor 1/2 (TLR1/2)	Toll-like receptor (TLR)	Em-Myc Mice (a Mouse model for Human Burkitt lymphoma and non-Hodgkin lymphomas)	B-cell lymphoma cell lines	cell surface	NA	NA	NA	TLR2 forms a heterodimer with TLR1 in response to Pam3CSK4 leading to the recruitment of the adaptor proteins MAL and MYD88 and the activation of IL1 receptor-associated kinase 4 (IRAK4), IRAK1, and TNF receptor-associated factor 6	ELISA	24799523	2014	NA
PRRID_1526	Pam3CSK4 Click for more detail	Bacteria	CCCCCCCCCCCCCCCC(=O)NC(CSCC(COC(=O)CCCCCCCCCCCCCCC)OC(=O)CCCCCCCCCCCCCCC)C(=O)NC(CO)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)O	NA	Lipoprotein	Synthetic	increases the immunogenicity of B- cell lymphoma cells and alters their trafficking pattern when combined with the genotoxic anticancer drug 1-b-D-arabinofuranosylcytosine.	Toll-like receptor 1/2 (TLR1/2)	Toll-like receptor (TLR)	Em-Myc Mice (a Mouse model for Human Burkitt lymphoma and non-Hodgkin lymphomas)	B-cell lymphoma cell lines	cell surface	NA	NA	NA	TLR2 forms a heterodimer with TLR1 in response to Pam3CSK4 leading to the recruitment of the adaptor proteins MAL and MYD88 and the activation of IL1 receptor-associated kinase 4 (IRAK4), IRAK1, and TNF receptor-associated factor 6	ELISA	24799523	2014	NA
PRRID_1529	Pam3CSK4 Click for more detail	Bacteria	CCCCCCCCCCCCCCCC(=O)NC(CSCC(COC(=O)CCCCCCCCCCCCCCC)OC(=O)CCCCCCCCCCCCCCC)C(=O)NC(CO)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)O	NA	Lipoprotein	Synthetic	triacylated lipopeptide potent activator of the proinflammatory transcription factor NF-Œ∫B.	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice	monocyte/macrophages	cell surface	Q9QUN7.fasta	Q9QUN7	784	plays a fundamental role in pathogen recognition and activation of innate immunity	ELISA	24771854	2014	Pubchem_assay
PRRID_1529	Pam3CSK4 Click for more detail	Bacteria	CCCCCCCCCCCCCCCC(=O)NC(CSCC(COC(=O)CCCCCCCCCCCCCCC)OC(=O)CCCCCCCCCCCCCCC)C(=O)NC(CO)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)O	NA	Lipoprotein	Synthetic	triacylated lipopeptide potent activator of the proinflammatory transcription factor NF-Œ∫B.	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice	monocyte/macrophages	cell surface	Q9QUN7.fasta	Q9QUN7	784	plays a fundamental role in pathogen recognition and activation of innate immunity	ELISA	24771854	2014	Pubchem_assay
PRRID_1530	Pam3CSK4 Click for more detail	Bacteria	CCCCCCCCCCCCCCCC(=O)NC(CSCC(COC(=O)CCCCCCCCCCCCCCC)OC(=O)CCCCCCCCCCCCCCC)C(=O)NC(CO)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)O	NA	Lipoprotein	Synthetic	triacylated lipopeptide potent activator of the proinflammatory transcription factor NF-Œ∫B.	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	monocyte/macrophages	cell surface	O60603.fasta	O60603	784	plays a fundamental role in pathogen recognition and activation of innate immunity	ELISA	24771854	2014	Pubchem_assay
PRRID_1530	Pam3CSK4 Click for more detail	Bacteria	CCCCCCCCCCCCCCCC(=O)NC(CSCC(COC(=O)CCCCCCCCCCCCCCC)OC(=O)CCCCCCCCCCCCCCC)C(=O)NC(CO)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)O	NA	Lipoprotein	Synthetic	triacylated lipopeptide potent activator of the proinflammatory transcription factor NF-Œ∫B.	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	monocyte/macrophages	cell surface	O60603.fasta	O60603	784	plays a fundamental role in pathogen recognition and activation of innate immunity	ELISA	24771854	2014	Pubchem_assay
PRRID_1531	Pam3CSK4 Click for more detail	Bacteria	CCCCCCCCCCCCCCCC(=O)NC(CSCC(COC(=O)CCCCCCCCCCCCCCC)OC(=O)CCCCCCCCCCCCCCC)C(=O)NC(CO)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)O	NA	Lipoprotein	Synthetic	triacylated lipopeptide potent activator of the proinflammatory transcription factor NF-Œ∫B.	Toll-like receptor (TLR1/Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice	monocyte/macrophages	cell surface	NA	NA	NA	plays a fundamental role in pathogen recognition and activation of innate immunity	ELISA	24771328	2014	NA
PRRID_1531	Pam3CSK4 Click for more detail	Bacteria	CCCCCCCCCCCCCCCC(=O)NC(CSCC(COC(=O)CCCCCCCCCCCCCCC)OC(=O)CCCCCCCCCCCCCCC)C(=O)NC(CO)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)O	NA	Lipoprotein	Synthetic	triacylated lipopeptide potent activator of the proinflammatory transcription factor NF-Œ∫B.	Toll-like receptor (TLR1/Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice	monocyte/macrophages	cell surface	NA	NA	NA	plays a fundamental role in pathogen recognition and activation of innate immunity	ELISA	24771328	2014	NA
PRRID_1532	Pam3CSK4 Click for more detail	Bacteria	CCCCCCCCCCCCCCCC(=O)NC(CSCC(COC(=O)CCCCCCCCCCCCCCC)OC(=O)CCCCCCCCCCCCCCC)C(=O)NC(CO)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)O	NA	Lipoprotein	Synthetic	triacylated lipopeptide potent activator of the proinflammatory transcription factor NF-Œ∫B.	Toll-like receptor (TLR1/Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	monocyte/macrophages	cell surface	NA	NA	NA	plays a fundamental role in pathogen recognition and activation of innate immunity	ELISA	24771328	2014	NA
PRRID_1532	Pam3CSK4 Click for more detail	Bacteria	CCCCCCCCCCCCCCCC(=O)NC(CSCC(COC(=O)CCCCCCCCCCCCCCC)OC(=O)CCCCCCCCCCCCCCC)C(=O)NC(CO)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)O	NA	Lipoprotein	Synthetic	triacylated lipopeptide potent activator of the proinflammatory transcription factor NF-Œ∫B.	Toll-like receptor (TLR1/Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	monocyte/macrophages	cell surface	NA	NA	NA	plays a fundamental role in pathogen recognition and activation of innate immunity	ELISA	24771328	2014	NA
PRRID_1652	Triacetylated lipoproteins Click for more detail	Bacteria	CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1	NA	Lipoprotein	Natural	elicit innate immune response	Toll-like receptor 1/2 (TLR1/2)	Toll-like receptor (TLR)	Mice	monocyte/macrophages, DCs, B-lymphocytes	extracellular domains of leucine-rich repeat motifs	NA	NA	NA	significant role in the pathogenesis of severe inflammatory responses	NA	24754320	2014	NA
PRRID_1652	Triacetylated lipoproteins Click for more detail	Bacteria	CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1	NA	Lipoprotein	Natural	elicit innate immune response	Toll-like receptor 1/2 (TLR1/2)	Toll-like receptor (TLR)	Mice	monocyte/macrophages, DCs, B-lymphocytes	extracellular domains of leucine-rich repeat motifs	NA	NA	NA	significant role in the pathogenesis of severe inflammatory responses	NA	24754320	2014	NA
PRRID_1653	Triacetylated lipoproteins Click for more detail	Bacteria	CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1	NA	Lipoprotein	Natural	elicit innate immune response	Toll-like receptor 1/2 (TLR1/2)	Toll-like receptor (TLR)	Human	monocyte/macrophages, DCs, B-lymphocytes	extracellular domains of leucine-rich repeat motifs	NA	NA	NA	significant role in the pathogenesis of severe inflammatory responses	NA	24754320	2014	NA
PRRID_1653	Triacetylated lipoproteins Click for more detail	Bacteria	CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1	NA	Lipoprotein	Natural	elicit innate immune response	Toll-like receptor 1/2 (TLR1/2)	Toll-like receptor (TLR)	Human	monocyte/macrophages, DCs, B-lymphocytes	extracellular domains of leucine-rich repeat motifs	NA	NA	NA	significant role in the pathogenesis of severe inflammatory responses	NA	24754320	2014	NA
PRRID_1878	Triacetylated lipoproteins Click for more detail	Mycobacteria (Bacteria)	CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1	NA	Lipoprotein	Natural	Immunostimulant	Toll-like receptor 1 (TLR1)	Toll-like receptor (TLR)	Mice	Plasma membrane	extracellular domain containing leucine-rich repeats and an intracellular domain that contains a conserved region called the Toll/IL-1 receptor (TIR) domain and the trans membrane domain	Q9EPQ1.fasta	Q9EPQ1	795	increase TNF-a and IL-6	NA	27756604	2016	Pubchem_assay
PRRID_1878	Triacetylated lipoproteins Click for more detail	Mycobacteria (Bacteria)	CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1	NA	Lipoprotein	Natural	Immunostimulant	Toll-like receptor 1 (TLR1)	Toll-like receptor (TLR)	Mice	Plasma membrane	extracellular domain containing leucine-rich repeats and an intracellular domain that contains a conserved region called the Toll/IL-1 receptor (TIR) domain and the trans membrane domain	Q9EPQ1.fasta	Q9EPQ1	795	increase TNF-a and IL-6	NA	27756604	2016	Pubchem_assay
PRRID_2057	FSL-1 Click for more detail	Mycoplasma (Bacteria)	CCCCCCCCCCCCCCCC(=O)OCC(CSC[C@@H](C(=O)NCC(=O)N[C@@H](CC(=O)O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC2=CN=CN2)C(=O)N3CCC[C@H]3C(=O)N[C@@H](CCCCN)C(=ON[C@@H(COC(=O)N[C@@H](CC4=CC=CC=C4)C(=O)O)N)OC(=O)CCCCCCCCCCCCCCC	NA	Lipoprotein	Synthetic	anti- inflammatory activity	Toll-like receptor 6 /2 (TLR6/2)	Toll-like receptor (TLR)	Human	U937 cells	Leucine-rich Repeat (LRR) Domain	NA	NA	NA	NA	NA	29113797	2017	NA
PRRID_2057	FSL-1 Click for more detail	Mycoplasma (Bacteria)	CCCCCCCCCCCCCCCC(=O)OCC(CSC[C@@H](C(=O)NCC(=O)N[C@@H](CC(=O)O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC2=CN=CN2)C(=O)N3CCC[C@H]3C(=O)N[C@@H](CCCCN)C(=ON[C@@H(COC(=O)N[C@@H](CC4=CC=CC=C4)C(=O)O)N)OC(=O)CCCCCCCCCCCCCCC	NA	Lipoprotein	Synthetic	anti- inflammatory activity	Toll-like receptor 6 /2 (TLR6/2)	Toll-like receptor (TLR)	Human	U937 cells	Leucine-rich Repeat (LRR) Domain	NA	NA	NA	NA	NA	29113797	2017	NA
PRRID_2222	LipL32 Click for more detail	Gram negative bacteria(Leptospira spp.)	NA	NA	Lipoprotein	Natural	NA	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice	surface of epithelial cells and macrophages.	Leucine-rich Repeat (LRR) Domain	Q9QUN7.fasta	Q9QUN7	784	NA	NA	29038956	2017	Pubchem_assay
PRRID_2222	LipL32 Click for more detail	Gram negative bacteria(Leptospira spp.)	NA	NA	Lipoprotein	Natural	NA	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice	surface of epithelial cells and macrophages.	Leucine-rich Repeat (LRR) Domain	Q9QUN7.fasta	Q9QUN7	784	NA	NA	29038956	2017	Pubchem_assay

previous 123 4 next