Primary information |
---|
PRRID | PRRID_0664 |
Ligand Name | LpqH |
Source | Mtb H37Ra (Bacteria) |
Sequence of ligand | MKRGLTVAVAGAAILVAGLSGCSSNKSTTGSGETTTAAGTTASPGAASGPKVVIDGKDQNVTGSVVCTTAAGNVNIAIGGAATGIAAVLTDGNPPEVKSVGLGNVNGVTLGYTSGTGQGNASATKDGSHYKITGTATGVDMANPMSPVNKSFEIEVTCS |
Length | 159 |
Type | Lipoprotein |
Occurence | Natural |
Role of Ligand | It activate antibacterial autophagy through vitamin D receptor signalling activation and cathelicidin induction. |
Name of receptor | Toll-like receptor 2 (TLR2) |
Type of receptor | Toll-like receptor (TLR) |
Source | Human |
Localization | Primary Monocytes |
Domain | Leucine-rich Repeat (LRR) Domain |
Sequence of Receptor | O60603.fasta |
Swiss prot ID | O60603 |
Length Of Receptor | 784 |
Function | It leads to the clearance of the pathogen via autophagy |
Assay used | NA |
PMID | 20560977 |
Year of Publication | 2010 |
Pubchem assay | Pubchem Assay |
Primary information |
---|
PRRID | PRRID_0664 |
Ligand Name | LpqH |
Source | Mtb H37Ra (Bacteria) |
Sequence of ligand | MKRGLTVAVAGAAILVAGLSGCSSNKSTTGSGETTTAAGTTASPGAASGPKVVIDGKDQNVTGSVVCTTAAGNVNIAIGGAATGIAAVLTDGNPPEVKSVGLGNVNGVTLGYTSGTGQGNASATKDGSHYKITGTATGVDMANPMSPVNKSFEIEVTCS |
Length | 159 |
Type | Lipoprotein |
Occurence | Natural |
Role of Ligand | It activate antibacterial autophagy through vitamin D receptor signalling activation and cathelicidin induction. |
Name of receptor | Toll-like receptor 2 (TLR2) |
Type of receptor | Toll-like receptor (TLR) |
Source | Human |
Localization | Primary Monocytes |
Domain | Leucine-rich Repeat (LRR) Domain |
Sequence of Receptor | O60603.fasta |
Swiss prot ID | O60603 |
Length Of Receptor | 784 |
Function | It leads to the clearance of the pathogen via autophagy |
Assay used | NA |
PMID | 20560977 |
Year of Publication | 2010 |
Pubchem assay | Pubchem Assay |