| Primary information |
|---|
| PRRID | PRRID_0666 |
| Ligand Name | LpqH |
| Source | Mtb H37Ra (Bacteria) |
| Sequence of ligand | MKRGLTVAVAGAAILVAGLSGCSSNKSTTGSGETTTAAGTTASPGAASGPKVVIDGKDQNVTGSVVCTTAAGNVNIAIGGAATGIAAVLTDGNPPEVKSVGLGNVNGVTLGYTSGTGQGNASATKDGSHYKITGTATGVDMANPMSPVNKSFEIEVTCS |
| Length | 159 |
| Type | Lipoprotein |
| Occurence | Natural |
| Role of Ligand | It activate antibacterial autophagy through vitamin D receptor signalling activation and cathelicidin induction. |
| Name of receptor | cluster of differentiation 14 (CD14) |
| Type of receptor | Pattern recognition receptor (PRR) |
| Source | Human |
| Localization | Primary Monocytes |
| Domain | Leucine-rich Repeat (LRR) Domain |
| Sequence of Receptor | P08571.fasta |
| Swiss prot ID | P08571 |
| Length Of Receptor | 375 |
| Function | It leads to the clearance of the pathogen via autophagy |
| Assay used | NA |
| PMID | 20560977 |
| Year of Publication | 2010 |
| Pubchem assay | Pubchem Assay |
| Primary information |
|---|
| PRRID | PRRID_0666 |
| Ligand Name | LpqH |
| Source | Mtb H37Ra (Bacteria) |
| Sequence of ligand | MKRGLTVAVAGAAILVAGLSGCSSNKSTTGSGETTTAAGTTASPGAASGPKVVIDGKDQNVTGSVVCTTAAGNVNIAIGGAATGIAAVLTDGNPPEVKSVGLGNVNGVTLGYTSGTGQGNASATKDGSHYKITGTATGVDMANPMSPVNKSFEIEVTCS |
| Length | 159 |
| Type | Lipoprotein |
| Occurence | Natural |
| Role of Ligand | It activate antibacterial autophagy through vitamin D receptor signalling activation and cathelicidin induction. |
| Name of receptor | cluster of differentiation 14 (CD14) |
| Type of receptor | Pattern recognition receptor (PRR) |
| Source | Human |
| Localization | Primary Monocytes |
| Domain | Leucine-rich Repeat (LRR) Domain |
| Sequence of Receptor | P08571.fasta |
| Swiss prot ID | P08571 |
| Length Of Receptor | 375 |
| Function | It leads to the clearance of the pathogen via autophagy |
| Assay used | NA |
| PMID | 20560977 |
| Year of Publication | 2010 |
| Pubchem assay | Pubchem Assay |