Browse result page of PRRDB 2.0
| PRRID | Name of Ligand | Source of ligand | Sequence of Ligand | Length of Ligand | Type of Ligand | Occurence | Role of Ligand | Name of Receptor | Type of Reeptor | Source of the Receptor | Localization | Domain | Sequence of Receptor | Swiss prot ID | Length of receptor | Function of Receptor | Assay used | PMID | Year of publication | Pubchem assay |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| PRRID_0860 | β -1,3-glucan Click for more detail | S. cerevisiae (Bacteria) | C(C1C(C(C(C(O1)OC2C(OC(C(C2O)O)OC3C(OC(C(C3O)O)O)CO)CO)O)O)O)O | NA | Carbohydrate | Natural | β-glucan binds to the LGBP and induce innate immunity | Lipopolysaccharide and b-1, 3-glucan binding protein (LGBP) | Pattern recognition receptor (PRR) | Chlamys farreri | Hemocytes, gills and mantle | NA | NA | NA | NA | It is involved in pathogens recognition and bacterial agglutination. | NA | 20659562 | 2010 | NA |
| PRRID_0860 | β -1,3-glucan Click for more detail | S. cerevisiae (Bacteria) | C(C1C(C(C(C(O1)OC2C(OC(C(C2O)O)OC3C(OC(C(C3O)O)O)CO)CO)O)O)O)O | NA | Carbohydrate | Natural | β-glucan binds to the LGBP and induce innate immunity | Lipopolysaccharide and b-1, 3-glucan binding protein (LGBP) | Pattern recognition receptor (PRR) | Chlamys farreri | Hemocytes, gills and mantle | NA | NA | NA | NA | It is involved in pathogens recognition and bacterial agglutination. | NA | 20659562 | 2010 | NA |
| PRRID_0861 | β -1,3-glucan Click for more detail | P. pastoris (fungi) | C(C1C(C(C(C(O1)OC2C(OC(C(C2O)O)OC3C(OC(C(C3O)O)O)CO)CO)O)O)O)O | NA | Carbohydrate | Natural | β-glucan binds to the LGBP and induce innate immunity | Lipopolysaccharide and b-1, 3-glucan binding protein (LGBP) | Pattern recognition receptor (PRR) | Chlamys farreri | Hemocytes, gills and mantle | NA | NA | NA | NA | It is involved in pathogen recognition and it's clearance | NA | 20659562 | 2010 | NA |
| PRRID_0861 | β -1,3-glucan Click for more detail | P. pastoris (fungi) | C(C1C(C(C(C(O1)OC2C(OC(C(C2O)O)OC3C(OC(C(C3O)O)O)CO)CO)O)O)O)O | NA | Carbohydrate | Natural | β-glucan binds to the LGBP and induce innate immunity | Lipopolysaccharide and b-1, 3-glucan binding protein (LGBP) | Pattern recognition receptor (PRR) | Chlamys farreri | Hemocytes, gills and mantle | NA | NA | NA | NA | It is involved in pathogen recognition and it's clearance | NA | 20659562 | 2010 | NA |
| PRRID_0862 | β -1,3-glucan Click for more detail | Candida albicans(fungi) | C(C1C(C(C(C(O1)OC2C(OC(C(C2O)O)OC3C(OC(C(C3O)O)O)CO)CO)O)O)O)O | NA | Carbohydrate | Natural | NA | GmCP10 | Pattern recognition receptor (PRR) | Galleria mellonella | hemolymph | NA | NA | NA | NA | It has opsonin activity for the phagocytosis of the microorganisms by hemocytes. | NA | 20519517 | 2010 | NA |
| PRRID_0862 | β -1,3-glucan Click for more detail | Candida albicans(fungi) | C(C1C(C(C(C(O1)OC2C(OC(C(C2O)O)OC3C(OC(C(C3O)O)O)CO)CO)O)O)O)O | NA | Carbohydrate | Natural | NA | GmCP10 | Pattern recognition receptor (PRR) | Galleria mellonella | hemolymph | NA | NA | NA | NA | It has opsonin activity for the phagocytosis of the microorganisms by hemocytes. | NA | 20519517 | 2010 | NA |
| PRRID_1020 | 1,3 beta glucan Click for more detail | S. cerevisiae (Bacteria) | C(C1C(C(C(C(O1)OC2C(OC(C(C2O)O)OC3C(OC(C(C3O)O)O)CO)CO)O)O)O)O | NA | Carbohydrate | Natural | elicit innate immune response | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Human | HEK293 cells | NA | O60603.fasta | O60603 | 784 | triggers the MyD88-dependent signaling pathway, leading to NF-kB activation | NF- | 24098508 | 2013 | Pubchem Assay |
| PRRID_1020 | 1,3 beta glucan Click for more detail | S. cerevisiae (Bacteria) | C(C1C(C(C(C(O1)OC2C(OC(C(C2O)O)OC3C(OC(C(C3O)O)O)CO)CO)O)O)O)O | NA | Carbohydrate | Natural | elicit innate immune response | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Human | HEK293 cells | NA | O60603.fasta | O60603 | 784 | triggers the MyD88-dependent signaling pathway, leading to NF-kB activation | NF- | 24098508 | 2013 | Pubchem Assay |
| PRRID_1051 | Glucan Click for more detail | S. cerevisiae (Bacteria) | C(C1C(C(C(C(O1)OC2C(OC(C(C2O)O)OC3C(OC(C(C3O)O)O)CO)CO)O)O)O)O | NA | Carbohydrate | Natural | elicit innate immune response | CgToll-like receptor 3 (TLR3) | Toll-like receptor (TLR) | C. gigas | HEK293 cells | NA | NA | NA | NA | NA | NF- | 24098508 | 2013 | NA |
| PRRID_1051 | Glucan Click for more detail | S. cerevisiae (Bacteria) | C(C1C(C(C(C(O1)OC2C(OC(C(C2O)O)OC3C(OC(C(C3O)O)O)CO)CO)O)O)O)O | NA | Carbohydrate | Natural | elicit innate immune response | CgToll-like receptor 3 (TLR3) | Toll-like receptor (TLR) | C. gigas | HEK293 cells | NA | NA | NA | NA | NA | NF- | 24098508 | 2013 | NA |
| PRRID_1053 | Glycolipids Click for more detail | Treponema maltophilum (others) | NA | NA | Carbohydrate | Natural | triggers immune responses | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Mice | monocyte/macrophages, DCs, B-lymphocytes | extracellular domains of leucine-rich repeat motifs | Q9QUN7.fasta | Q9QUN7 | 784 | significant role in the pathogenesis of severe inflammatory responses | NA | 23985302 | 2013 | Pubchem_assay |
| PRRID_1053 | Glycolipids Click for more detail | Treponema maltophilum (others) | NA | NA | Carbohydrate | Natural | triggers immune responses | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Mice | monocyte/macrophages, DCs, B-lymphocytes | extracellular domains of leucine-rich repeat motifs | Q9QUN7.fasta | Q9QUN7 | 784 | significant role in the pathogenesis of severe inflammatory responses | NA | 23985302 | 2013 | Pubchem_assay |
| PRRID_1138 | Serum amyloid Click for more detail | Endogenous (others) | MKLLTGLVFCSLVLGVSSRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGVWAAEAISDARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY | 122 | Carbohydrate | Natural | elicit innate immune response | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Mice | monocyte/macrophages, DCs, B-lymphocytes | extracellular domains of leucine-rich repeat motifs | Q9QUN7.fasta | Q9QUN7 | 784 | significant role in the pathogenesis of severe inflammatory responses | NA | 23985302 | 2013 | Pubchem_assay |
| PRRID_1138 | Serum amyloid Click for more detail | Endogenous (others) | MKLLTGLVFCSLVLGVSSRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGVWAAEAISDARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY | 122 | Carbohydrate | Natural | elicit innate immune response | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Mice | monocyte/macrophages, DCs, B-lymphocytes | extracellular domains of leucine-rich repeat motifs | Q9QUN7.fasta | Q9QUN7 | 784 | significant role in the pathogenesis of severe inflammatory responses | NA | 23985302 | 2013 | Pubchem_assay |
| PRRID_1227 | Curdlan Click for more detail | Bacteria | NA | NA | Carbohydrate | Synthetic | used in gel production | Dectin-1 | C type Lectin (CTL/CLR) | European and African Children | NA | NA | Q9BXN2.fasta | Q9BXN2 | 247 | Phagocytosis of pathogens, Antigen presentation, Intracellular signalling, Resolution of inflammation | ELISA | 24743542 | 2014 | Pubchem_assay |
| PRRID_1227 | Curdlan Click for more detail | Bacteria | NA | NA | Carbohydrate | Synthetic | used in gel production | Dectin-1 | C type Lectin (CTL/CLR) | European and African Children | NA | NA | Q9BXN2.fasta | Q9BXN2 | 247 | Phagocytosis of pathogens, Antigen presentation, Intracellular signalling, Resolution of inflammation | ELISA | 24743542 | 2014 | Pubchem_assay |
| PRRID_1469 | D-mannose Click for more detail | Bacteria | C(C1C(C(C(C(O1)O)O)O)O)O | NA | Carbohydrate | Natural | NA | ERGIC-53 | Pattern recognition receptor (PRR) | NA | NA | NA | NA | NA | NA | NA | NA | 24796868 | 2014 | NA |
| PRRID_1469 | D-mannose Click for more detail | Bacteria | C(C1C(C(C(C(O1)O)O)O)O)O | NA | Carbohydrate | Natural | NA | ERGIC-53 | Pattern recognition receptor (PRR) | NA | NA | NA | NA | NA | NA | NA | NA | 24796868 | 2014 | NA |
| PRRID_1497 | N-glycolylated muramic acid Click for more detail | Mycobacterium smegmatis and Mycobacterium tuberculosis (Bacteria) | CC(C(=O)O)OC1C(C(OC(C1O)CO)O)NC(=O)C | NA | Carbohydrate | Natural | activates NOD2 | Nod-like receptor 1 (NLR1) | NOD-like receptor (NLR) | Mice | immune cells like peripheral blood monocytes, granulocytes and dendritic cells, as well as in astrocytes of the brain and in paneth cells of the gut | intracellular receptors | Q8K3Z0.fasta | Q8K3Z0 | 1020 | Nod2, are associ- ated with inflammatory bowel disease in humans | NA | 24779390 | 2014 | Pubchem_assay |
| PRRID_1497 | N-glycolylated muramic acid Click for more detail | Mycobacterium smegmatis and Mycobacterium tuberculosis (Bacteria) | CC(C(=O)O)OC1C(C(OC(C1O)CO)O)NC(=O)C | NA | Carbohydrate | Natural | activates NOD2 | Nod-like receptor 1 (NLR1) | NOD-like receptor (NLR) | Mice | immune cells like peripheral blood monocytes, granulocytes and dendritic cells, as well as in astrocytes of the brain and in paneth cells of the gut | intracellular receptors | Q8K3Z0.fasta | Q8K3Z0 | 1020 | Nod2, are associ- ated with inflammatory bowel disease in humans | NA | 24779390 | 2014 | Pubchem_assay |
| PRRID_1498 | N-glycolylated muramic acid Click for more detail | Mycobacterium smegmatis and Mycobacterium tuberculosis (Bacteria) | CC(C(=O)O)OC1C(C(OC(C1O)CO)O)NC(=O)C | NA | Carbohydrate | Natural | activates NOD2 | Nod-like receptor 1 (NLR1) | NOD-like receptor (NLR) | Human | immune cells like peripheral blood monocytes, granulocytes and dendritic cells, as well as in astrocytes of the brain and in paneth cells of the gut | intracellular receptors | Q9HC29.fasta | Q9HC29 | 1040 | Nod2, are associ- ated with inflammatory bowel disease in humans | NA | 24779390 | 2014 | Pubchem_assay |
| PRRID_1498 | N-glycolylated muramic acid Click for more detail | Mycobacterium smegmatis and Mycobacterium tuberculosis (Bacteria) | CC(C(=O)O)OC1C(C(OC(C1O)CO)O)NC(=O)C | NA | Carbohydrate | Natural | activates NOD2 | Nod-like receptor 1 (NLR1) | NOD-like receptor (NLR) | Human | immune cells like peripheral blood monocytes, granulocytes and dendritic cells, as well as in astrocytes of the brain and in paneth cells of the gut | intracellular receptors | Q9HC29.fasta | Q9HC29 | 1040 | Nod2, are associ- ated with inflammatory bowel disease in humans | NA | 24779390 | 2014 | Pubchem_assay |
| PRRID_1510 | D-mannose Click for more detail | Bacteria | C(C1C(C(C(C(O1)O)O)O)O)O | NA | Carbohydrate | Natural | NA | VIP36 | Pattern recognition receptor (PRR) | NA | NA | NA | NA | NA | NA | NA | NA | 24796868 | 2014 | NA |
| PRRID_1510 | D-mannose Click for more detail | Bacteria | C(C1C(C(C(C(O1)O)O)O)O)O | NA | Carbohydrate | Natural | NA | VIP36 | Pattern recognition receptor (PRR) | NA | NA | NA | NA | NA | NA | NA | NA | 24796868 | 2014 | NA |
| PRRID_1590 | polysaccharides (MAMPs) Click for more detail | Bacteria | NA | NA | Carbohydrate | Natural | NA | Calnexin (Cnx) | Pattern recognition receptor (PRR) | Marsupenaeus japonicus | transmembrane chaperone | NA | NA | NA | NA | NA | NA | 24858031 | 2014 | NA |
| PRRID_1590 | polysaccharides (MAMPs) Click for more detail | Bacteria | NA | NA | Carbohydrate | Natural | NA | Calnexin (Cnx) | Pattern recognition receptor (PRR) | Marsupenaeus japonicus | transmembrane chaperone | NA | NA | NA | NA | NA | NA | 24858031 | 2014 | NA |
| PRRID_1694 | Fucoidan Click for more detail | NA | CC1C(C(C(C(O1)C)OS(=O)(=O)O)O)O | NA | Carbohydrate | Natural | Immunostimulant | LvLGBP | Pattern recognition receptor (PRR) | Litopenaeus vannamei | Hemocytes | NA | NA | NA | NA | cause degranulation, and activate the proPO system that subsequently leads to an increase in PO activity, indicating the activation of innate immunity. | ELISA | 26522339 | 2015 | NA |
| PRRID_1694 | Fucoidan Click for more detail | NA | CC1C(C(C(C(O1)C)OS(=O)(=O)O)O)O | NA | Carbohydrate | Natural | Immunostimulant | LvLGBP | Pattern recognition receptor (PRR) | Litopenaeus vannamei | Hemocytes | NA | NA | NA | NA | cause degranulation, and activate the proPO system that subsequently leads to an increase in PO activity, indicating the activation of innate immunity. | ELISA | 26522339 | 2015 | NA |
| PRRID_1742 | Fucose Click for more detail | HIV-1 (virus) | CC(C(C(C(C=O)O)O)O)O | NA | Carbohydrate | Natural | Immunostimulant | DCIR | C type Lectin (CTL/CLR) | Human | NA | NA | NA | NA | NA | Inhibition of APC functions such as cytokine production | NA | 27999992 | 2016 | NA |
| PRRID_1742 | Fucose Click for more detail | HIV-1 (virus) | CC(C(C(C(C=O)O)O)O)O | NA | Carbohydrate | Natural | Immunostimulant | DCIR | C type Lectin (CTL/CLR) | Human | NA | NA | NA | NA | NA | Inhibition of APC functions such as cytokine production | NA | 27999992 | 2016 | NA |
| PRRID_1743 | Fucose Click for more detail | S. pneumoniae, K. pneumoniae, C. albicans, P.carinii, HIV-1, Dengue virus | CC(C(C(C(C=O)O)O)O)O | NA | Carbohydrate | Natural | Immunostimulant | MMR | C type Lectin (CTL/CLR) | Human | NA | NA | NA | NA | NA | Pathogen recognition; Antigen uptake; Cell adhesion; Phagocytosis | NA | 27999992 | 2016 | NA |
| PRRID_1743 | Fucose Click for more detail | S. pneumoniae, K. pneumoniae, C. albicans, P.carinii, HIV-1, Dengue virus | CC(C(C(C(C=O)O)O)O)O | NA | Carbohydrate | Natural | Immunostimulant | MMR | C type Lectin (CTL/CLR) | Human | NA | NA | NA | NA | NA | Pathogen recognition; Antigen uptake; Cell adhesion; Phagocytosis | NA | 27999992 | 2016 | NA |
| PRRID_1745 | Glucan Click for more detail | S. cerevisiae (Bacteria) | C(C1C(C(C(C(O1)OC2C(OC(C(C2O)O)OC3C(OC(C(C3O)O)O)CO)CO)O)O)O)O | NA | Carbohydrate | Natural | It enhances microbe agglutination and haemocytes encapsulation. | Galectin | Pattern recognition receptor (PRR) | Eriocheir sinensis | Hepatopancreas | CRD | NA | NA | NA | It provies immune defense against invading microbes. | ELISA | 27095174 | 2016 | NA |
| PRRID_1745 | Glucan Click for more detail | S. cerevisiae (Bacteria) | C(C1C(C(C(C(O1)OC2C(OC(C(C2O)O)OC3C(OC(C(C3O)O)O)CO)CO)O)O)O)O | NA | Carbohydrate | Natural | It enhances microbe agglutination and haemocytes encapsulation. | Galectin | Pattern recognition receptor (PRR) | Eriocheir sinensis | Hepatopancreas | CRD | NA | NA | NA | It provies immune defense against invading microbes. | ELISA | 27095174 | 2016 | NA |
| PRRID_1781 | Glucan Click for more detail | Bacteria | C(C1C(C(C(C(O1)OC2C(OC(C(C2O)O)OC3C(OC(C(C3O)O)O)CO)CO)O)O)O)O | NA | Carbohydrate | Natural | NA | CfLRRop-3 | Leucine rich repeats (LRR) | NA | NA | NA | NA | NA | NA | NA | NA | 26826425 | 2016 | NA |
| PRRID_1781 | Glucan Click for more detail | Bacteria | C(C1C(C(C(C(O1)OC2C(OC(C(C2O)O)OC3C(OC(C(C3O)O)O)CO)CO)O)O)O)O | NA | Carbohydrate | Natural | NA | CfLRRop-3 | Leucine rich repeats (LRR) | NA | NA | NA | NA | NA | NA | NA | NA | 26826425 | 2016 | NA |
| PRRID_1890 | 1,3 beta glucan Click for more detail | Candida albicans(fungi) | C(C1C(C(C(C(O1)OC2C(OC(C(C2O)O)OC3C(OC(C(C3O)O)O)CO)CO)O)O)O)O | NA | Carbohydrate | Natural | Immunostimulant | Dectin-1 (Clec7a) | Syk-coupled CLR | Mice | NA | NA | Q6QLQ4.fasta | Q6QLQ4 | 244 | protective role in infection model | NA | 28167651 | 2017 | Pubchem_assay |
| PRRID_1890 | 1,3 beta glucan Click for more detail | Candida albicans(fungi) | C(C1C(C(C(C(O1)OC2C(OC(C(C2O)O)OC3C(OC(C(C3O)O)O)CO)CO)O)O)O)O | NA | Carbohydrate | Natural | Immunostimulant | Dectin-1 (Clec7a) | Syk-coupled CLR | Mice | NA | NA | Q6QLQ4.fasta | Q6QLQ4 | 244 | protective role in infection model | NA | 28167651 | 2017 | Pubchem_assay |
| PRRID_1891 | 1,3 beta glucan Click for more detail | Candida albicans(fungi) | C(C1C(C(C(C(O1)OC2C(OC(C(C2O)O)OC3C(OC(C(C3O)O)O)CO)CO)O)O)O)O | NA | Carbohydrate | Natural | Immunostimulant | Dectin-1 (Clec7a) | Syk-coupled CLR | Human | NA | NA | Q9BXN2.fasta | Q9BXN2 | 247 | protective role in infection model | NA | 28167651 | 2017 | Pubchem_assay |
| PRRID_1891 | 1,3 beta glucan Click for more detail | Candida albicans(fungi) | C(C1C(C(C(C(O1)OC2C(OC(C(C2O)O)OC3C(OC(C(C3O)O)O)CO)CO)O)O)O)O | NA | Carbohydrate | Natural | Immunostimulant | Dectin-1 (Clec7a) | Syk-coupled CLR | Human | NA | NA | Q9BXN2.fasta | Q9BXN2 | 247 | protective role in infection model | NA | 28167651 | 2017 | Pubchem_assay |
| PRRID_1892 | 1,3 beta glucan Click for more detail | Fungi | C(C1C(C(C(C(O1)OC2C(OC(C(C2O)O)OC3C(OC(C(C3O)O)O)CO)CO)O)O)O)O | NA | Carbohydrate | Natural | elicit innate immune response | Dectin-1 | C type Lectin (CTL/CLR) | NA | NA | NA | NA | NA | NA | NA | NA | 27288407 | 2017 | NA |
| PRRID_1892 | 1,3 beta glucan Click for more detail | Fungi | C(C1C(C(C(C(O1)OC2C(OC(C(C2O)O)OC3C(OC(C(C3O)O)O)CO)CO)O)O)O)O | NA | Carbohydrate | Natural | elicit innate immune response | Dectin-1 | C type Lectin (CTL/CLR) | NA | NA | NA | NA | NA | NA | NA | NA | 27288407 | 2017 | NA |
| PRRID_1957 | Biglycan Click for more detail | Proteoglycan (others) | MWPLWRLVSLLALSQALPFEQRGFWDFTLDDGPFMMNDEEASGADTSGVLDPDSVTPTYSAMCPFGCHCHLRVVQCSDLGLKSVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYVRSWEEPAGLQQRAGVRALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSLVELRIHDNRIRKVPKGVFSGLRNMNCIEMGGNPLENSGFEPGAFDGLKLNYLRISEAKLT | 238 | Carbohydrate | Natural | involved in the resolution and fine-tuning of inflammation by orchestrating the production of anti-inflammatory mediators that are required for the resolution of tissue inflammation and the transition to acquired immunity | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | NA | NA | Leucine-rich Repeat (LRR) Domain | NA | NA | NA | NA | NA | 29290139 | 2017 | NA |
| PRRID_1957 | Biglycan Click for more detail | Proteoglycan (others) | MWPLWRLVSLLALSQALPFEQRGFWDFTLDDGPFMMNDEEASGADTSGVLDPDSVTPTYSAMCPFGCHCHLRVVQCSDLGLKSVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYVRSWEEPAGLQQRAGVRALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSLVELRIHDNRIRKVPKGVFSGLRNMNCIEMGGNPLENSGFEPGAFDGLKLNYLRISEAKLT | 238 | Carbohydrate | Natural | involved in the resolution and fine-tuning of inflammation by orchestrating the production of anti-inflammatory mediators that are required for the resolution of tissue inflammation and the transition to acquired immunity | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | NA | NA | Leucine-rich Repeat (LRR) Domain | NA | NA | NA | NA | NA | 29290139 | 2017 | NA |
| PRRID_1958 | Biglycan Click for more detail | Proteoglycan (others) | MWPLWRLVSLLALSQALPFEQRGFWDFTLDDGPFMMNDEEASGADTSGVLDPDSVTPTYSAMCPFGCHCHLRVVQCSDLGLKSVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYVRSWEEPAGLQQRAGVRALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSLVELRIHDNRIRKVPKGVFSGLRNMNCIEMGGNPLENSGFEPGAFDGLKLNYLRISEAKLT | 238 | Carbohydrate | Natural | involved in the resolution and fine-tuning of inflammation by orchestrating the production of anti-inflammatory mediators that are required for the resolution of tissue inflammation and the transition to acquired immunity | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | NA | NA | Leucine-rich Repeat (LRR) Domain | NA | NA | NA | NA | NA | 29290139 | 2017 | NA |
| PRRID_1958 | Biglycan Click for more detail | Proteoglycan (others) | MWPLWRLVSLLALSQALPFEQRGFWDFTLDDGPFMMNDEEASGADTSGVLDPDSVTPTYSAMCPFGCHCHLRVVQCSDLGLKSVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYVRSWEEPAGLQQRAGVRALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSLVELRIHDNRIRKVPKGVFSGLRNMNCIEMGGNPLENSGFEPGAFDGLKLNYLRISEAKLT | 238 | Carbohydrate | Natural | involved in the resolution and fine-tuning of inflammation by orchestrating the production of anti-inflammatory mediators that are required for the resolution of tissue inflammation and the transition to acquired immunity | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | NA | NA | Leucine-rich Repeat (LRR) Domain | NA | NA | NA | NA | NA | 29290139 | 2017 | NA |
| PRRID_1959 | Biglycan Click for more detail | Proteoglycan (others) | MWPLWRLVSLLALSQALPFEQRGFWDFTLDDGPFMMNDEEASGADTSGVLDPDSVTPTYSAMCPFGCHCHLRVVQCSDLGLKSVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYVRSWEEPAGLQQRAGVRALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSLVELRIHDNRIRKVPKGVFSGLRNMNCIEMGGNPLENSGFEPGAFDGLKLNYLRISEAKLT | 238 | Carbohydrate | Natural | involved in the resolution and fine-tuning of inflammation by orchestrating the production of anti-inflammatory mediators that are required for the resolution of tissue inflammation and the transition to acquired immunity | Nod-like receptor P3 (NLRP3) | NOD-like receptor (NLR) | NA | NA | Leucine-rich Repeat (LRR) Domain | NA | NA | NA | NA | NA | 29290139 | 2017 | NA |
| PRRID_1959 | Biglycan Click for more detail | Proteoglycan (others) | MWPLWRLVSLLALSQALPFEQRGFWDFTLDDGPFMMNDEEASGADTSGVLDPDSVTPTYSAMCPFGCHCHLRVVQCSDLGLKSVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYVRSWEEPAGLQQRAGVRALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSLVELRIHDNRIRKVPKGVFSGLRNMNCIEMGGNPLENSGFEPGAFDGLKLNYLRISEAKLT | 238 | Carbohydrate | Natural | involved in the resolution and fine-tuning of inflammation by orchestrating the production of anti-inflammatory mediators that are required for the resolution of tissue inflammation and the transition to acquired immunity | Nod-like receptor P3 (NLRP3) | NOD-like receptor (NLR) | NA | NA | Leucine-rich Repeat (LRR) Domain | NA | NA | NA | NA | NA | 29290139 | 2017 | NA |
| PRRID_1960 | Biglycan Click for more detail | NA | MWPLWRLVSLLALSQALPFEQRGFWDFTLDDGPFMMNDEEASGADTSGVLDPDSVTPTYSAMCPFGCHCHLRVVQCSDLGLKSVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYVRSWEEPAGLQQRAGVRALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSLVELRIHDNRIRKVPKGVFSGLRNMNCIEMGGNPLENSGFEPGAFDGLKLNYLRISEAKLT | 238 | Carbohydrate | Natural | Induce the secretion of TNF-α, MIP-2 and IL-1β by murine macrophages | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Mice | Macrophages | Leucine-rich Repeat (LRR) Domain | Q9QUN7.fasta | Q9QUN7 | 784 | NA | NA | 28961019 | 2017 | Pubchem_assay |
| PRRID_1960 | Biglycan Click for more detail | NA | MWPLWRLVSLLALSQALPFEQRGFWDFTLDDGPFMMNDEEASGADTSGVLDPDSVTPTYSAMCPFGCHCHLRVVQCSDLGLKSVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYVRSWEEPAGLQQRAGVRALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSLVELRIHDNRIRKVPKGVFSGLRNMNCIEMGGNPLENSGFEPGAFDGLKLNYLRISEAKLT | 238 | Carbohydrate | Natural | Induce the secretion of TNF-α, MIP-2 and IL-1β by murine macrophages | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Mice | Macrophages | Leucine-rich Repeat (LRR) Domain | Q9QUN7.fasta | Q9QUN7 | 784 | NA | NA | 28961019 | 2017 | Pubchem_assay |
| PRRID_1961 | Biglycan Click for more detail | NA | MWPLWRLVSLLALSQALPFEQRGFWDFTLDDGPFMMNDEEASGADTSGVLDPDSVTPTYSAMCPFGCHCHLRVVQCSDLGLKSVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYVRSWEEPAGLQQRAGVRALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSLVELRIHDNRIRKVPKGVFSGLRNMNCIEMGGNPLENSGFEPGAFDGLKLNYLRISEAKLT | 238 | Carbohydrate | Natural | Induce the secretion of TNF-α, MIP-2 and IL-1β by murine macrophages | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Mice | Macrophages | Q9QUK6 | Q9QUK6.fasta | Q9QUK6 | 835 | NA | NA | 28961019 | 2017 | Pubchem_assay |
| PRRID_1961 | Biglycan Click for more detail | NA | MWPLWRLVSLLALSQALPFEQRGFWDFTLDDGPFMMNDEEASGADTSGVLDPDSVTPTYSAMCPFGCHCHLRVVQCSDLGLKSVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYVRSWEEPAGLQQRAGVRALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSLVELRIHDNRIRKVPKGVFSGLRNMNCIEMGGNPLENSGFEPGAFDGLKLNYLRISEAKLT | 238 | Carbohydrate | Natural | Induce the secretion of TNF-α, MIP-2 and IL-1β by murine macrophages | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Mice | Macrophages | Q9QUK6 | Q9QUK6.fasta | Q9QUK6 | 835 | NA | NA | 28961019 | 2017 | Pubchem_assay |
| PRRID_1962 | Biglycan Click for more detail | NA | MWPLWRLVSLLALSQALPFEQRGFWDFTLDDGPFMMNDEEASGADTSGVLDPDSVTPTYSAMCPFGCHCHLRVVQCSDLGLKSVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYVRSWEEPAGLQQRAGVRALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSLVELRIHDNRIRKVPKGVFSGLRNMNCIEMGGNPLENSGFEPGAFDGLKLNYLRISEAKLT | 238 | Carbohydrate | Natural | Induce the secretion of TNF-α, MIP-2 and IL-1β by murine macrophages | Nod-like receptor P3 (NLRP3) | NOD-like receptor (NLR) | Mice | Macrophages | NA | Q8R4B8.fasta | Q8R4B8 | 1033 | NA | NA | 28961019 | 2017 | Pubchem_assay |
| PRRID_1962 | Biglycan Click for more detail | NA | MWPLWRLVSLLALSQALPFEQRGFWDFTLDDGPFMMNDEEASGADTSGVLDPDSVTPTYSAMCPFGCHCHLRVVQCSDLGLKSVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYVRSWEEPAGLQQRAGVRALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSLVELRIHDNRIRKVPKGVFSGLRNMNCIEMGGNPLENSGFEPGAFDGLKLNYLRISEAKLT | 238 | Carbohydrate | Natural | Induce the secretion of TNF-α, MIP-2 and IL-1β by murine macrophages | Nod-like receptor P3 (NLRP3) | NOD-like receptor (NLR) | Mice | Macrophages | NA | Q8R4B8.fasta | Q8R4B8 | 1033 | NA | NA | 28961019 | 2017 | Pubchem_assay |
| PRRID_2073 | Glucan Click for more detail | Bacteria | C(C1C(C(C(C(O1)OC2C(OC(C(C2O)O)OC3C(OC(C(C3O)O)O)CO)CO)O)O)O)O | NA | Carbohydrate | Natural | elicit innate immune response | AmphiCTL1 | C type Lectin (CTL/CLR) | B. belcheri | NA | NA | NA | NA | NA | NA | NA | 29055189 | 2017 | NA |
| PRRID_2073 | Glucan Click for more detail | Bacteria | C(C1C(C(C(C(O1)OC2C(OC(C(C2O)O)OC3C(OC(C(C3O)O)O)CO)CO)O)O)O)O | NA | Carbohydrate | Natural | elicit innate immune response | AmphiCTL1 | C type Lectin (CTL/CLR) | B. belcheri | NA | NA | NA | NA | NA | NA | NA | 29055189 | 2017 | NA |
| PRRID_2074 | Glucan Click for more detail | Bacteria | C(C1C(C(C(C(O1)OC2C(OC(C(C2O)O)OC3C(OC(C(C3O)O)O)CO)CO)O)O)O)O | NA | Carbohydrate | Natural | innate immunity elicitor | rPtCTL-2 | C type Lectin (CTL/CLR) | Portunus trituberculatus | NA | Carbohydrate recognition Domain | NA | NA | NA | recognize nonself invaders and also work as an opsonin to eliminate invaders | PAMPs binding assay | 28916358 | 2017 | NA |
| PRRID_2074 | Glucan Click for more detail | Bacteria | C(C1C(C(C(C(O1)OC2C(OC(C(C2O)O)OC3C(OC(C(C3O)O)O)CO)CO)O)O)O)O | NA | Carbohydrate | Natural | innate immunity elicitor | rPtCTL-2 | C type Lectin (CTL/CLR) | Portunus trituberculatus | NA | Carbohydrate recognition Domain | NA | NA | NA | recognize nonself invaders and also work as an opsonin to eliminate invaders | PAMPs binding assay | 28916358 | 2017 | NA |
| PRRID_2075 | Glucan Click for more detail | NA | C(C1C(C(C(C(O1)OC2C(OC(C(C2O)O)OC3C(OC(C(C3O)O)O)CO)CO)O)O)O)O | NA | Carbohydrate | Natural | innate immunity elicitor | CgLRRIG-1 | Pattern recognition receptor (PRR) | oyster Crassostrea gigas | Muscle, gill, hepatopancreas, mantle, gonad and hemocytes with the highest expression level in hepatopancreas. | Leucine-rich repeat (LRR) domain and immunoglobulin (Ig) domain | NA | NA | NA | immune effectors or pro-inflammatory factors as well as PRRs in oyster. | PAMPs binding assay | 28889011 | 2017 | NA |
| PRRID_2075 | Glucan Click for more detail | NA | C(C1C(C(C(C(O1)OC2C(OC(C(C2O)O)OC3C(OC(C(C3O)O)O)CO)CO)O)O)O)O | NA | Carbohydrate | Natural | innate immunity elicitor | CgLRRIG-1 | Pattern recognition receptor (PRR) | oyster Crassostrea gigas | Muscle, gill, hepatopancreas, mantle, gonad and hemocytes with the highest expression level in hepatopancreas. | Leucine-rich repeat (LRR) domain and immunoglobulin (Ig) domain | NA | NA | NA | immune effectors or pro-inflammatory factors as well as PRRs in oyster. | PAMPs binding assay | 28889011 | 2017 | NA |
| PRRID_2076 | Glucan Click for more detail | NA | C(C1C(C(C(C(O1)OC2C(OC(C(C2O)O)OC3C(OC(C(C3O)O)O)CO)CO)O)O)O)O | NA | Carbohydrate | Natural | innate immunity elicitor | CgLRRIG-2 | Pattern recognition receptor (PRR) | oyster Crassostrea gigas | Muscle, gill, hepatopancreas, mantle, gonad and hemocytes with the highest expression level in hepatopancreas. | Leucine-rich repeat (LRR) domain and immunoglobulin (Ig) domain | NA | NA | NA | immune effectors or pro-inflammatory factors as well as PRRs in oyster. | PAMPs binding assay | 28889011 | 2017 | NA |
| PRRID_2076 | Glucan Click for more detail | NA | C(C1C(C(C(C(O1)OC2C(OC(C(C2O)O)OC3C(OC(C(C3O)O)O)CO)CO)O)O)O)O | NA | Carbohydrate | Natural | innate immunity elicitor | CgLRRIG-2 | Pattern recognition receptor (PRR) | oyster Crassostrea gigas | Muscle, gill, hepatopancreas, mantle, gonad and hemocytes with the highest expression level in hepatopancreas. | Leucine-rich repeat (LRR) domain and immunoglobulin (Ig) domain | NA | NA | NA | immune effectors or pro-inflammatory factors as well as PRRs in oyster. | PAMPs binding assay | 28889011 | 2017 | NA |
| PRRID_2077 | Glucan Click for more detail | Fungi | C(C1C(C(C(C(O1)OC2C(OC(C(C2O)O)OC3C(OC(C(C3O)O)O)CO)CO)O)O)O)O | NA | Carbohydrate | Natural | elicit innate immune response | Dectin-1 | C type Lectin (CTL/CLR) | NA | NA | NA | NA | NA | NA | NA | NA | 28801521 | 2017 | NA |
| PRRID_2077 | Glucan Click for more detail | Fungi | C(C1C(C(C(C(O1)OC2C(OC(C(C2O)O)OC3C(OC(C(C3O)O)O)CO)CO)O)O)O)O | NA | Carbohydrate | Natural | elicit innate immune response | Dectin-1 | C type Lectin (CTL/CLR) | NA | NA | NA | NA | NA | NA | NA | NA | 28801521 | 2017 | NA |
| PRRID_2078 | Glucan Click for more detail | S. cerevisiae (Bacteria) | C(C1C(C(C(C(O1)OC2C(OC(C(C2O)O)OC3C(OC(C(C3O)O)O)CO)CO)O)O)O)O | NA | Carbohydrate | Natural | Immunostimulant | Dectin-1 (Clec7a) | Syk-coupled CLR | Mice | NA | NA | Q6QLQ4.fasta | Q6QLQ4 | 244 | Protective role in infection model | NA | 28167651 | 2017 | Pubchem_assay |
| PRRID_2078 | Glucan Click for more detail | S. cerevisiae (Bacteria) | C(C1C(C(C(C(O1)OC2C(OC(C(C2O)O)OC3C(OC(C(C3O)O)O)CO)CO)O)O)O)O | NA | Carbohydrate | Natural | Immunostimulant | Dectin-1 (Clec7a) | Syk-coupled CLR | Mice | NA | NA | Q6QLQ4.fasta | Q6QLQ4 | 244 | Protective role in infection model | NA | 28167651 | 2017 | Pubchem_assay |
| PRRID_2082 | Glucan Click for more detail | Bacteria | C(C1C(C(C(C(O1)OC2C(OC(C(C2O)O)OC3C(OC(C(C3O)O)O)CO)CO)O)O)O)O | NA | Carbohydrate | Natural | elicit innate immune response | rPtCTL-2 | C type Lectin (CTL/CLR) | NA | NA | NA | NA | NA | NA | NA | NA | 28916358 | 2017 | NA |
| PRRID_2082 | Glucan Click for more detail | Bacteria | C(C1C(C(C(C(O1)OC2C(OC(C(C2O)O)OC3C(OC(C(C3O)O)O)CO)CO)O)O)O)O | NA | Carbohydrate | Natural | elicit innate immune response | rPtCTL-2 | C type Lectin (CTL/CLR) | NA | NA | NA | NA | NA | NA | NA | NA | 28916358 | 2017 | NA |
| PRRID_2084 | Glucan Click for more detail | Bacteria | C(C1C(C(C(C(O1)OC2C(OC(C(C2O)O)OC3C(OC(C(C3O)O)O)CO)CO)O)O)O)O | NA | Carbohydrate | Natural | elicit innate immune response | rPtCTL-2 | C type Lectin (CTL/CLR) | NA | NA | NA | NA | NA | NA | NA | NA | 28288910 | 2017 | NA |
| PRRID_2084 | Glucan Click for more detail | Bacteria | C(C1C(C(C(C(O1)OC2C(OC(C(C2O)O)OC3C(OC(C(C3O)O)O)CO)CO)O)O)O)O | NA | Carbohydrate | Natural | elicit innate immune response | rPtCTL-2 | C type Lectin (CTL/CLR) | NA | NA | NA | NA | NA | NA | NA | NA | 28288910 | 2017 | NA |
| PRRID_2700 | 1,3 beta glucan Click for more detail | Bacteria | C(C1C(C(C(C(O1)OC2C(OC(C(C2O)O)OC3C(OC(C(C3O)O)O)CO)CO)O)O)O)O | NA | Carbohydrate | Natural | NA | b-1,3-glucan recognition proteins | Gastrin-releasing peptide receptor (GRP) | NA | NA | NA | NA | NA | NA | NA | NA | 29032241 | 2018 | NA |
| PRRID_2700 | 1,3 beta glucan Click for more detail | Bacteria | C(C1C(C(C(C(O1)OC2C(OC(C(C2O)O)OC3C(OC(C(C3O)O)O)CO)CO)O)O)O)O | NA | Carbohydrate | Natural | NA | b-1,3-glucan recognition proteins | Gastrin-releasing peptide receptor (GRP) | NA | NA | NA | NA | NA | NA | NA | NA | 29032241 | 2018 | NA |
| PRRID_2706 | β-glucan Click for more detail | gram-negative bacteria, fungi | C(C1C(C(C(C(O1)OC2C(OC(C(C2O)O)OC3C(OC(C(C3O)O)O)CO)CO)O)O)O)O | NA | Carbohydrate | Natural | NA | rSgSABL-1 | Lectins | NA | NA | NA | NA | NA | NA | induces pro-inflammatory cytokine response | NA | 29146448 | 2018 | NA |
| PRRID_2706 | β-glucan Click for more detail | gram-negative bacteria, fungi | C(C1C(C(C(C(O1)OC2C(OC(C(C2O)O)OC3C(OC(C(C3O)O)O)CO)CO)O)O)O)O | NA | Carbohydrate | Natural | NA | rSgSABL-1 | Lectins | NA | NA | NA | NA | NA | NA | induces pro-inflammatory cytokine response | NA | 29146448 | 2018 | NA |
| PRRID_2709 | N-acetyl or N-glycolyl Click for more detail | NA | NA | NA | Carbohydrate | Natural | NA | Sialic acid-binding lectins (SABLs) | Lectins | NA | NA | NA | NA | NA | NA | induces pro-inflammatory cytokine response | NA | 29146448 | 2018 | NA |
| PRRID_2709 | N-acetyl or N-glycolyl Click for more detail | NA | NA | NA | Carbohydrate | Natural | NA | Sialic acid-binding lectins (SABLs) | Lectins | NA | NA | NA | NA | NA | NA | induces pro-inflammatory cytokine response | NA | 29146448 | 2018 | NA |