| Primary information |
|---|
| PRRID | PRRID_1959 |
| Ligand Name | Biglycan |
| Source | Proteoglycan (others) |
| Sequence of ligand | MWPLWRLVSLLALSQALPFEQRGFWDFTLDDGPFMMNDEEASGADTSGVLDPDSVTPTYSAMCPFGCHCHLRVVQCSDLGLKSVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYVRSWEEPAGLQQRAGVRALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSLVELRIHDNRIRKVPKGVFSGLRNMNCIEMGGNPLENSGFEPGAFDGLKLNYLRISEAKLT |
| Length | 238 |
| Type | Carbohydrate |
| Occurence | Natural |
| Role of Ligand | involved in the resolution and fine-tuning of inflammation by orchestrating the production of anti-inflammatory mediators that are required for the resolution of tissue inflammation and the transition to acquired immunity |
| Name of receptor | Nod-like receptor P3 (NLRP3) |
| Type of receptor | NOD-like receptor (NLR) |
| Source | NA |
| Localization | NA |
| Domain | Leucine-rich Repeat (LRR) Domain |
| Sequence of Receptor | NA |
| Swiss prot ID | NA |
| Length Of Receptor | NA |
| Function | NA |
| Assay used | NA |
| PMID | 29290139 |
| Year of Publication | 2017 |
| Pubchem assay | NA |
| Primary information |
|---|
| PRRID | PRRID_1959 |
| Ligand Name | Biglycan |
| Source | Proteoglycan (others) |
| Sequence of ligand | MWPLWRLVSLLALSQALPFEQRGFWDFTLDDGPFMMNDEEASGADTSGVLDPDSVTPTYSAMCPFGCHCHLRVVQCSDLGLKSVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYVRSWEEPAGLQQRAGVRALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSLVELRIHDNRIRKVPKGVFSGLRNMNCIEMGGNPLENSGFEPGAFDGLKLNYLRISEAKLT |
| Length | 238 |
| Type | Carbohydrate |
| Occurence | Natural |
| Role of Ligand | involved in the resolution and fine-tuning of inflammation by orchestrating the production of anti-inflammatory mediators that are required for the resolution of tissue inflammation and the transition to acquired immunity |
| Name of receptor | Nod-like receptor P3 (NLRP3) |
| Type of receptor | NOD-like receptor (NLR) |
| Source | NA |
| Localization | NA |
| Domain | Leucine-rich Repeat (LRR) Domain |
| Sequence of Receptor | NA |
| Swiss prot ID | NA |
| Length Of Receptor | NA |
| Function | NA |
| Assay used | NA |
| PMID | 29290139 |
| Year of Publication | 2017 |
| Pubchem assay | NA |