Primary information |
---|
PRRID | PRRID_1957 |
Ligand Name | Biglycan |
Source | Proteoglycan (others) |
Sequence of ligand | MWPLWRLVSLLALSQALPFEQRGFWDFTLDDGPFMMNDEEASGADTSGVLDPDSVTPTYSAMCPFGCHCHLRVVQCSDLGLKSVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYVRSWEEPAGLQQRAGVRALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSLVELRIHDNRIRKVPKGVFSGLRNMNCIEMGGNPLENSGFEPGAFDGLKLNYLRISEAKLT |
Length | 238 |
Type | Carbohydrate |
Occurence | Natural |
Role of Ligand | involved in the resolution and fine-tuning of inflammation by orchestrating the production of anti-inflammatory mediators that are required for the resolution of tissue inflammation and the transition to acquired immunity |
Name of receptor | Toll-like receptor 2 (TLR2) |
Type of receptor | Toll-like receptor (TLR) |
Source | NA |
Localization | NA |
Domain | Leucine-rich Repeat (LRR) Domain |
Sequence of Receptor | NA |
Swiss prot ID | NA |
Length Of Receptor | NA |
Function | NA |
Assay used | NA |
PMID | 29290139 |
Year of Publication | 2017 |
Pubchem assay | NA |
Primary information |
---|
PRRID | PRRID_1957 |
Ligand Name | Biglycan |
Source | Proteoglycan (others) |
Sequence of ligand | MWPLWRLVSLLALSQALPFEQRGFWDFTLDDGPFMMNDEEASGADTSGVLDPDSVTPTYSAMCPFGCHCHLRVVQCSDLGLKSVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYVRSWEEPAGLQQRAGVRALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSLVELRIHDNRIRKVPKGVFSGLRNMNCIEMGGNPLENSGFEPGAFDGLKLNYLRISEAKLT |
Length | 238 |
Type | Carbohydrate |
Occurence | Natural |
Role of Ligand | involved in the resolution and fine-tuning of inflammation by orchestrating the production of anti-inflammatory mediators that are required for the resolution of tissue inflammation and the transition to acquired immunity |
Name of receptor | Toll-like receptor 2 (TLR2) |
Type of receptor | Toll-like receptor (TLR) |
Source | NA |
Localization | NA |
Domain | Leucine-rich Repeat (LRR) Domain |
Sequence of Receptor | NA |
Swiss prot ID | NA |
Length Of Receptor | NA |
Function | NA |
Assay used | NA |
PMID | 29290139 |
Year of Publication | 2017 |
Pubchem assay | NA |