| Primary information |
|---|
| PRRID | PRRID_1138 |
| Ligand Name | Serum amyloid |
| Source | Endogenous (others) |
| Sequence of ligand | MKLLTGLVFCSLVLGVSSRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGVWAAEAISDARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY |
| Length | 122 |
| Type | Carbohydrate |
| Occurence | Natural |
| Role of Ligand | elicit innate immune response |
| Name of receptor | Toll-like receptor 2 (TLR2) |
| Type of receptor | Toll-like receptor (TLR) |
| Source | Mice |
| Localization | monocyte/macrophages, DCs, B-lymphocytes |
| Domain | extracellular domains of leucine-rich repeat motifs |
| Sequence of Receptor | Q9QUN7.fasta |
| Swiss prot ID | Q9QUN7 |
| Length Of Receptor | 784 |
| Function | significant role in the pathogenesis of severe inflammatory responses |
| Assay used | NA |
| PMID | 23985302 |
| Year of Publication | 2013 |
| Pubchem assay | Pubchem_assay |
| Primary information |
|---|
| PRRID | PRRID_1138 |
| Ligand Name | Serum amyloid |
| Source | Endogenous (others) |
| Sequence of ligand | MKLLTGLVFCSLVLGVSSRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGVWAAEAISDARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY |
| Length | 122 |
| Type | Carbohydrate |
| Occurence | Natural |
| Role of Ligand | elicit innate immune response |
| Name of receptor | Toll-like receptor 2 (TLR2) |
| Type of receptor | Toll-like receptor (TLR) |
| Source | Mice |
| Localization | monocyte/macrophages, DCs, B-lymphocytes |
| Domain | extracellular domains of leucine-rich repeat motifs |
| Sequence of Receptor | Q9QUN7.fasta |
| Swiss prot ID | Q9QUN7 |
| Length Of Receptor | 784 |
| Function | significant role in the pathogenesis of severe inflammatory responses |
| Assay used | NA |
| PMID | 23985302 |
| Year of Publication | 2013 |
| Pubchem assay | Pubchem_assay |