Result page of PRRDB 2.0
| PRRID | Name of Ligand | Source of ligand | Sequence of Ligand | Length of Ligand | Type of Ligand | Occurence | Role of Ligand | Name of Receptor | Type of Reeptor | Source of the Receptor | Localization | Domain | Sequence of Receptor | Swiss prot ID | Length of receptor | Function of Receptor | Assay used | PMID | Year of publication | Pubchem assay | Pdb | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| PRRID_0001 | Porins Click for more detail | Neisseria meningitidis (Bacteria) | MRKKLTALVLSALPLAAVADVSLYGEIKAGVEGRNYQLQLTEAQAANGGASGQVKVTKVTKAKSRIRTKISDFGSFIGFKGSEDLGDGLKAVWQLEQDVSVAGGGATQWGNRESFIGLAGEFGTLRAGRVANQFDDASQAIDPWDSNNDVASQLGIFKRHDDMPVSVRYDSPEFSGFSGSVQFVPIQNSKSAYTPAYYTKNTNNNLTLVPAVVGKPGSDVYYAGLNYKNGGFAGNYAFKYARHANVGRNAFELFLIGSARSDQAKGTDPLKNHQVHRLTGGYEEGGLNLALAAQLDLSENGDKAKTKNSTTEIAATASYRFGNAVPRISYAHGFDFIERGKKGENTSYDQIIAGVDYDFSKRTSAIVSGAWLKRNTGIGNYTQINAASVGLRHKF | 396 | Protein | Natural | elicit innate immune response | Mannose-binding lectins | Mannose receptor | Human | NA | NA | B1PN75.fasta | B1PN75 | 38 | MBL binding to N. meningitidis and increases complement activation and killing of organisms. | ELISA | 15004183 | 2004 | NA | PRR_0001.pdb| PRRID_0002 | polyinosinic-polycytidylic acid [poly(I:C)] | Click for more detail NA | C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O | NA | Nucleic Acid | Synthetic | It results into the induction of type I IFNs | TLR3 | TLR | Chicken | Spleenocytes | Leucine-rich Repeat (LRR) Domain | D6R3C9.fasta | D6R3C9 | 66 | Immunostimulation | NA | 20692289 | 2010 | NA | PRR_0002.pdb | PRRID_0003 | HMGB1 | Click for more detail NA | MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE | 215 | Protein | Natural | promoting neuroinflammation | CD24 | PRR | Human | NA | NA | P25063.fasta | P25063 | 80 | Activate NF-KB | NA | 28049142 | 2017 | NA | PRR_0003.pdb | PRRID_0004 | Heat shock protein | Click for more detail NA | NA | NA | DAMPs | Natural | nduce the maturation and activation of pDCs. | CD91 | PRR | Human | pDCs | Leucine-rich Repeat (LRR) Domain | Q71UW0.fasta | Q71UW0 | 92 | NA | NA | 28961019 | 2017 | NA | PRR_0004.pdb | PRRID_0005 | Peptidoglycan (PGN) | Click for more detail Gram negative bacteria, Gram-positive bacteria | CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N | NA | Peptidoglycan | Natural | Immunostimulant | DjCTL | CTL | Dugesia japonica | Pharyngeal and epidermis | Doamin of CLECT | A0A1L2DBR5.fasta | A0A1L2DBR5 | 107 | foreign invaders and phagocytize or encapsulate the aggregates of killed bacteria which have been digested in intestinal cavity. | Microbial binding assay | 27565408 | 2016 | NA | PRR_0005.pdb | PRRID_0006 | NA | Click for more detail E. coli(Bacteria) | MKIKTGARILALSALTTMMFSASALAKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTRITK | 396 | PAMP | Natural | elicit innate immune response | CTL4 | CTL | Anopheles gambiae | NA | NA | B2FX81.fasta | B2FX81 | 150 | NA | NA | 29051762 | 2017 | NA | PRR_0006.pdb | PRRID_0007 | mt-DNA | Click for more detail All vertebrates(others) | NA | NA | Nucleic Acid | Natural | Cellular injury and necrosis | TLR9 | TLR | Human | Granulocytes and monocytes | Leucine-rich Repeat (LRR) Domain | Q9NR96.fasta | Q9NRN6 | 154 | release of interferon type 1 and TNF-a through the activation of IL-1R-associated kinase 1, 2, and 4 and the phosphorylation of p38 MAPK | NA | 28049142 | 2017 | NA | PRR_0007.pdb | PRRID_0008 | NA | Click for more detail E. coli(Bacteria) | MKIKTGARILALSALTTMMFSASALAKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTRITK | 396 | DAMPs | Natural | elicit innate immune response | CTLMA2 | CTL | Anopheles gambiae | NA | NA | B2FX57.fasta | B2FX57 | 165 | NA | NA | 29051762 | 2017 | NA | PRR_0008.pdb | PRRID_0009 | Mannose and fucose | Click for more detail L. monocytogenes (Bacteria) | C(C1C(C(C(C(O1)O)O)O)O)O and CC(C(C(C(C=O)O)O)O)O | NA | PAMP | Natural | Activation of CLEC5A | CLEC5A | CTL | Human | monocytes, macrophages and neutrophils. | NA | Q14DL9.fasta | Q14DL9 | 165 | secretion of proinflammatory cytokines such as TNF, IL-6, CXCL-8, and IP-10. | Binding assay | 28824166 | 2017 | NA | PRR_0009.pdb | PRRID_0010 | Teneligliptin | Click for more detail NA | CC1=NN(C(=C1)N2CCN(CC2)C3CC(NC3)C(=O)N4CCSC4)C5=CC=CC=C5 | NA | DPP4 inhibitor | Natural | anti- inflammatory activity | cav-1 | PRR | Mice | Macrophages | Leucine-rich Repeat (LRR) Domain | P49817.fasta | P49817 | 178 | NA | NA | 29113797 | 2017 | NA | PRR_0010.pdb | PRRID_0011 | TDM | Click for more detail Mycobacterium spp.(Bacteria) | NA | NA | PAMP | Natural | Immunostimulant | Mincle(Clec4e) | Syk-coupled CLR | Mice | NA | NA | Q9R0Q8.fasta | Q9R0Q8 | 214 | Protective role in infection model | NA | 28167651 | 2017 | NA | PRR_0011.pdb | PRRID_0012 | TDM | Click for more detail Mycobacterium spp.(Bacteria) | NA | NA | PAMP | Natural | Immunostimulant | Mcl (Clec4d) | Syk-coupled CLR | Mice | NA | NA | Q9Z2H6.fasta | Q9Z2H6 | 219 | Protective role in infection model | NA | 28167651 | 2017 | NA | PRR_0012.pdb | PRRID_0013 | b-1,3-glucans. | Click for more detail Candida glabrata(fungi) | C(C1C(C(C(C(O1)OC2C(OC(C(C2O)O)OC3C(OC(C(C3O)O)O)CO)CO)O)O)O)O | NA | PAMP | Natural | Binding and activation of Dectin -1 | Dectin-1 | CTL | Mice | Macrophages | NA | Q9BXN2.fasta | Q9BXN2 | 247 | activation of the NF-κB and MAPK pathways | Binding assay | 28658592 | 2017 | NA | PRR_0013.pdb | PRRID_0014 | Staphylococcus aureus | Click for more detail S. aureus (Bacteria) | NA | NA | Whole cell | Natural | The recognition specificity for bacteria is determine by the chemokine domain of SR-PSOX/CXCL16. | SR-PSOX/CXCL16 | Scavenger receptor | Human | Macrophages and Dendritic cells | Chemokine domain | Q9H2A7.fasta | Q9H2A7 | 254 | SR-PSOX/CXCL16 mediates bacterial adhesion and phagocytosis. | ELISA | 12902461 | 2003 | NA | PRR_0014.pdb | PRRID_0015 | NA | Click for more detail S. pneumoniae (Bacteria) | NA | NA | PAMP | Natural | Immunostimulant | collectin kidney 1 (CL-K1) | CTL | Mice | NA | NA | Q3SXB8.fasta | Q3SXB8 | 272 | binds to microbes and activates the lectin complement pathway | NA | 28068663 | 2017 | NA | PRR_0015.pdb | PRRID_0016 | anti-citrullinated protein antibody-positive (ACPA+) RA. | Click for more detail Present in the majority of patients with Rheumatoid arthritis (others) | NA | NA | NA | Natural | NA | Caspase-1 | NLR | Human | mast cells | NA | B4DVD8.fasta | B4DVD8 | 301 | contribute to the protective functions of the immune cells | Flow cytometry | 24818634 | 2014 | NA | PRR_0016.pdb | PRRID_0017 | ssDNA | Click for more detail NA | NA | NA | NA | Natural | Immunostimulant | TREX1/exonuclease | PRR | Human | Virion Cytosol | NA | Q9NSU2.fasta | Q9NSU2 | 314 | dNMPs | NA | 22982943 | 2012 | NA | PRR_0017.pdb | PRRID_0018 | oxidized LDL (OxLDL) | Click for more detail Host (Endogenous) (others) | CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1 | NA | Lipoprotein | Natural | OxLDL pretreatment increased expression of macrosialin. | Microsialin | Scavenger receptor | Mice | Peritoneal macrophages | NA | A0A0R4J1C8.fasta | A0A0R4J1C8 | 335 | It leads to the binding and uptake of oxidised form of LDL by resident mouse peritoneal macrophages. | Endocytic degradation assays | 9598839 | 1998 | NA | PRR_0018.pdb | PRRID_0019 | fMLF | Click for more detail NA | NA | NA | Peptide | Synthetic | It activates the PMN in circukation and promote the Ca2+ flux and phosphorylation of MAP kinases | Formyl peptide receptor-1 | PRR | Human | Neutrophils | NA | P21462.fasta | P21462 | 350 | It incites non-specific organ attack and suppresses chemotactic responsess to infective stimuli. | Chemotaxis assay | 20203610 | 2010 | NA | PRR_0019.pdb | PRRID_0020 | P2Y2PalIC3 | Click for more detail NA | NA | NA | PAMP | Natural | innate immunity elicitor | FPR2(Formyl peptide Receptor2) | PRR | Human | Neutrophils | Seven alpha helical transmembrane domains | P25090.fasta | P25090 | 351 | tissue homeostasis, host defence reactivity and regulation of immune reactions and inflammation, | Neutrophil NADPH oxidase assay | 28881079 | 2017 | NA | PRR_0020.pdb | PRRID_0021 | Hypochlorite modified HDL | Click for more detail Host (Endogenous) (others) | CC(C)CCCC(C)C1CCC2C1(CCC3C2CC=C4C3(CCC(C4)O)C)C | NA | Lipoprotein | Natural | It has a high affinity for the Lectin-like oxidized low density lipoprotein receptor 1 (LOX-1). | Lectin-like oxidized LDLreceptor-1 | CTL | Mice (Murine) | CHO Cells—ldlA cells | NA | Q9EQ09.fasta | Q9EQ09 | 363 | It impairs high density lipoprotein-dependent selective lipid uptake and reverse cholesterol transport. | NA | 12070141 | 2002 | NA | PRR_0021.pdb | PRRID_0022 | Lipopolysaccharide (LPS) | Click for more detail Escherichia coli serotype 0127:B8 (Bacteria) | CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC | NA | LPS | Natural | Binding of LPS trigger the NFKB pathway. | CD14 | PRR | Wistar Rat | Pineal gland (pinealocytes) | NA | Q63691.fasta | Q63691 | 372 | The pineal gland transduces Gram-negative endotoxin stimulation by producing TNF and inhibiting melatonin synthesis | NA | 20586888 | 2010 | NA | PRR_0022.pdb | PRRID_0023 | NA | Click for more detail NA | NA | NA | NA | Natural | NA | PTX3 | PRR | Human | NA | NA | P26022.fasta | P26022 | 381 | NA | NA | 29066255 | 2017 | NA | PRR_0023.pdb | PRRID_0024 | dsDNA | Click for more detail Vesicular stomatitis (virus) | NA | NA | Nucleic Acid | Natural | LRRFIP1 bound β-catenin and promoted the activation of β-catenin, which subsequently bound IRF3 which leads to the production of IFN-β | LRRFIP2 | Cytosolic receptor | RAW264.7 cells | cytoplasm | NA | Q91WK0.fasta | Q91WK0 | 415 | It induce the production of type I interferon is important for pathogen elimination. | ELISA | 20453844 | 2010 | NA | PRR_0024.pdb | PRRID_0025 | β-galactosides | Click for more detail Leishmania major (others) | C(C1C(C(C(C(O1)O)O)O)O)O | NA | PAMP | Natural | cutaneous and visceral leishmaniasis | Gal-3 | PRR | Mice | lymph nodes and higher parasite load in the footpads | carbohydrate recognition domain | Q9JHE4 .fasta | Q9JHE4 | 423 | via modulation of the Notch signaling pathway | NA | 28986248 | 2018 | NA | PRR_0025.pdb | PRRID_0026 | Long ds RNA | Click for more detail EMCV, poliovirus and coxasackie virus; Rotavirus, dengue virus, WNV, murine hepatitis virus(virus) | NA | NA | PAMP | Natural | filament formation mediated receptor tetramerization | MDA5 | RLR | Human | Cytoplasm, all mammalian cell types | NA | Q53TB6.fasta | Q53TB6 | 435 | MAVS-TRAF3-TBK1/ IKKe-IRF3. MAVS-FADD/ TRAF6-IKKs-NF-jB | NA | 28374903 | 2017 | NA | PRR_0026.pdb | PRRID_0027 | LPS and β-1,3-glucan | Click for more detail Bacteria | CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC | NA | Glycoprotein | Natural | NA | TmGNBP1 | GNBPs | Tenebrio molitor | membrane localised | NA | B1B5K2.fasta | B1B5K2 | 442 | NA | Antibacterial activity assay | 18195005 | 2008 | NA | PRR_0027.pdb | PRRID_0028 | Mannan | Click for more detail Fungi(Yeast) | N[C@@H](CCC[C@@H](NC(=O)CC[C@@H](N)C(O)=O)C(O)=O)C(O)=O | NA | Polysaccharides | Natural | cell wall polysaccharide found in yeasts. | Mannose receptor | Mannose receptor | European and African Children | DC-SIGN (dendritic cell-specific intercellular adhesion molecule-3-grabbing non-integrin) | NA | A5D8T8.fasta | A5D8T8 | 446 | Phagocytosis of pathogens, Antigen presentation, Intracellular signalling, Resolution of inflammation | ELISA | 24743542 | 2014 | NA | PRR_0028.pdb | PRRID_0029 | Advanced Glycation End Products (AGE) | Click for more detail Host (Endogenous) (others) | NA | NA | Protein | Natural | AGE is a potent activator of MSR. | Macrophage Scavenger Receptor (MSR) | Scavenger receptor | Human | Macrophages | NA | P21757.fasta | P21757 | 451 | The MSR mediates the endocytic uptake and degradation of AGE proteins. | NA | 7607209 | 1995 | NA | PRR_0029.pdb | PRRID_0030 | rBanLec | Click for more detail E. coli(Bacteria) | NA | NA | NA | Synthetic | Immunostimulant | CD4 | PRR | Mice | Peritoneal macrophages | NA | P06332.fasta | P06332 | 457 | production of TNFα and NO in BALB/c macrophages. | ELISA | 28235050 | 2017 | NA | PRR_0030.pdb | PRRID_0031 | NA | Click for more detail Acanthocheilonema viteae(others) | NA | NA | PAMP | Natural | NA | Scavenger receptor class A | Scavenger receptor | Mice | lamina propria macrophage | NA | Q08857.fasta | Q08857 | 472 | It protect against microbial induced pregnancy loss | NA | 20711846 | 2010 | NA | PRR_0031.pdb | PRRID_0032 | Cryptococcus neoformans | Click for more detail Cryptococcus neoformans(fungi) | NA | NA | Whole organism | Natural | It inducs the production of IL-1beta , TNF, IL-12 p40 , IFN- gamma, MIP-2, MIP-1 alpha , MIP-1 beta, RANTES, and IP-10. | SCARF1 | Scavenger receptor | Mice | Macropahges | NA | Q68EF1.fasta | Q68EF1 | 474 | Macrophages phagocytose and kill C. neoformans and binding of these fungi to endothelial cells initiates tissue invasion. | NA | 19237602 | 2009 | NA | PRR_0032.pdb | PRRID_0033 | NA | Click for more detail NA | NA | NA | NA | NA | NA | PTX4 | PRR | Human | NA | NA | Q96A99.fasta | Q96A99 | 478 | NA | NA | 29066255 | 2017 | NA | PRR_0033.pdb | PRRID_0034 | Lipopolysaccharide (LPS) | Click for more detail Pseudomonas aeruginosa (Bacteria) | CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC | NA | LPS | Natural | stimulation of THP-1 macrophages | MUC1 mucin | PRR | Human | surface of epithelial cells and some hematopoietic cells | NA | A0A087X2A4.fasta | A0A087X2A4 | 484 | phagocytic activity and cytokine production | ELISA | 28822766 | 2017 | NA | PRR_0034.pdb | PRRID_0035 | GW4064 | Click for more detail NA | NA | NA | PAMP | Natural | GW4064 attenuated LPS-induced ileum injury and mitochondria dysfunction by sup- pressed TLR4/MyD88 signaling-mediated inflammation and apoptosis. | Farnesoid X receptor (FXR) | PRR | Mice | Macrophages | NA | Q60641.fasta | Q60641 | 488 | role in enteroprotection and mucosal injury by regulating inflammatory responses and barrier function in the intestinal tract. | RT-qPCR | 28647362 | 2017 | NA | PRR_0035.pdb | PRRID_0036 | Hypochlorite modified HDL | Click for more detail Host (Endogenous) (others) | CC(C)CCCC(C)C1CCC2C1(CCC3C2CC=C4C3(CCC(C4)O)C)C | NA | Lipoprotein | Natural | It has a high affinity for the Lectin-like oxidized low density lipoprotein receptor 1 (LOX-1). | Scavenger receptor class B, type I (SR-BI) | Scavenger receptor | Mice (Murine) | CHO Cells—ldlA cells | NA | Q06BI8.fasta | Q06BI8 | 494 | It impairs high density lipoprotein-dependent selective lipid uptake and reverse cholesterol transport. | NA | 12070141 | 2002 | NA | PRR_0036.pdb | PRRID_0037 | b-1,3-glucan and lipopolysaccharide | Click for more detail Gram positive bacteria | C(C1C(C(C(C(O1)OC2C(OC(C(C2O)O)OC3C(OC(C(C3O)O)O)CO)CO)O)O)O)O | NA | Peptidoglycan | Natural | NA | DmGNBP1 | GNBPs | Drosophila melanogaster | membrane localised | NA | Q9NHB0.fasta | Q9NHB0 | 494 | NA | NA | 29229443 | 2017 | NA | PRR_0037.pdb | PRRID_0038 | Bacterial Antigen | Click for more detail L. monocytogenes (Bacteria) | NA | NA | NA | Natural | It's binding leads to the bacterial uptake via phagocytosis | class B scavenger receptor type I (SR-BI) | Scavenger receptor | Mice | Trophoblast giant cells and J774 cells | NA | Q61009.fasta | Q61009 | 509 | It helps in placental defense system by extracellular bacterial antigen uptake via phagocytosis. | NA | 20471681 | 2010 | NA | PRR_0038.pdb | PRRID_0039 | Uric acid | Click for more detail NA | C12=C(NC(=O)N1)NC(=O)NC2=O | NA | DAMPs | Natural | Induce the synthesis of IL-1β, TNF-α and TGF-β by murine macrophages. | TLR2 | TLR | Mice (Murine) | Macrophages | Leucine-rich Repeat (LRR) Domain | Q9NR97.fasta | Q9QUK7 | 511 | NA | NA | 28961019 | 2017 | NA | PRR_0039.pdb | PRRID_0040 | Staphylococcus aureus | Click for more detail S. aureus (Bacteria) | NA | NA | Whole cell | Natural | S. aureus binds with MARCO with high affinity | MARCO | Scavenger receptor | Mice | Macrophages | NA | A2RT24.fasta | A2RT24 | 518 | It plays a role in immunological reactions. | Immunoprecipitation | 7867067 | 1995 | NA | PRR_0040.pdb | PRRID_0041 | NA | Click for more detail NA | NA | NA | NA | NA | NA | MARCO | Scavenger receptor | Human | NA | NA | Q9UEW3.fasta | Q9UEW3 | 520 | NA | NA | 29066255 | 2017 | NA | PRR_0041.pdb | PRRID_0042 | dsDNA | Click for more detail HSV-1 (virus) | NA | NA | Nucleic Acid | Natural | It mediate IFNs and cytokine production | RNA Pol-III | DNA receptor | Mice (Murine) | Cytoplasm | NA | Q9D483.fasta | Q9D483 | 533 | It has the role in the inflammation. | NA | 20739519 | 2010 | NA | PRR_0042.pdb | PRRID_0043 | Fungal chitin | Click for more detail Candida albicans(fungi) | NA | NA | NA | Natural | NA | CARD9 | NLR | Human | myeloid cells, | Caspase Recruitment Domain | Q9H257.fasta | Q9H257 | 536 | NA | Invasive CNS candidiasis | 29307770 | 2018 | NA | PRR_0043.pdb | PRRID_0044 | muramyl tripeptide | Click for more detail Mycobacteria (Bacteria) | CCCCCCCCCCCCCCCC(=O)OCC(COP(=O)(O)OCCNC(=O)C(C)NC(=O)CCC(C(=O)N)NC(=O)C(C)NC(=O)C(C)OC1C(C(OC(C1O)CO)O)NC(=O)C)OC(=O)CCCCCCCCCCCCCCC | NA | Peptide | Natural | in vitro activates Nod | PGLYRP-2 | PGRP | Human | intraepithelial T lymphocytes | intracellular receptors | Q96PD5.fasta | Q96PD5 | 576 | recognises peptidoglycan of bacterial cell wall | NA | 24779390 | 2014 | NA | PRR_0044.pdb | PRRID_0045 | Lipopolysaccharide (LPS) | Click for more detail Pseudomonas aeruginosa (Bacteria) | CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC | NA | LPS | Natural | stimulation of THP-1 macrophages | MUC1 mucin | PRR | Mice | surface of epithelial cells and some hematopoietic cells | NA | Q02496.fasta | Q02496 | 630 | phagocytic activity and cytokine production | ELISA | 28822766 | 2017 | NA | PRR_0045.pdb | PRRID_0046 | Sindbis virus (SINV) RNA | Click for more detail Virus | NA | NA | PAMP | Natural | Immunostimulant | Tetrachlorodibenzo-p-dioxin (TCDD)- inducible poly(ADP ribose) polymerase (TIPARP) | PRR | Mice | Cytoplasm | zinc finger domain | Q8C1B2.fasta | Q8C1B2 | 657 | recruits an exosome to induce viral RNA degradation. | RNA immunoprecipitation Assay | 28213497 | 2017 | NA | PRR_0046.pdb | PRRID_0047 | Lipopolysaccharide (LPS) | Click for more detail Gram negative bacteria, Gram-positive bacteria | CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC | NA | LPS | Natural | Bacterial infection | MjSRC | Scavenger receptor | Marsupenaeus japonicus | hemocytes | CCP and MAM domains | A0A1L2DC21.fasta | A0A1L2DC21 | 692 | phagocytosis | NA | 28602682 | 2017 | NA | PRR_0047.pdb | PRRID_0048 | dsDNA | Click for more detail Listeria monocytogenes (Bacteria) | NA | NA | Nucleic Acid | Natural | LRRFIP1 bound β-catenin and promoted the activation of β-catenin, which subsequently bound IRF3 which leads to the production of IFN-β | LRRFIP1 | Cytosolic receptor | RAW264.7 cells | cytoplasm | NA | Q3UZ39.fasta | Q3UZ39 | 729 | It induce the production of type I interferon is important for pathogen elimination. | ELISA | 20453844 | 2010 | NA | PRR_0048.pdb | PRRID_0049 | Lipoprotein | Click for more detail Bacteria | NA | NA | PAMP | Natural | NA | TLR2 | TLR | Rat | brain (vasculature) | Leucine-rich Repeat (LRR) Domain | Q6YGU2.fasta | Q6YGU2 | 784 | protein ↑, activation in ischemic stroke | NA | 28801521 | 2017 | NA | PRR_0049.pdb | PRRID_0050 | Peptidoglycan (PGN) | Click for more detail Bacteria | CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N | NA | Peptidoglycan | Natural | elicit innate immune response | TLR2 | TLR | Chicken | splenocytes | cell surface | Q9DD78.fasta | Q9DD78 | 793 | TLR2 and TLR5 promote cellular activation and the production of cytokines including proinflammatory interleukin (IL)-6, as well as those cytokines that help to initiate and modulate the adaptive immune response, including IL-4, IL-12, and interferon (IFN)-c | ELISA | 24797722 | 2014 | NA | PRR_0050.pdb | |