Detailed description page of PRRDB2.0
| This page displays user query in tabular form. |
PRRID_0003 details |
| Primary information | |
|---|---|
| PRRID | PRRID_0003 |
| Ligand Name | HMGB1 |
| Source | NA |
| Sequence of ligand | MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE |
| Length | 215 |
| Type | Protein |
| Occurence | Natural |
| Role of Ligand | promoting neuroinflammation |
| Name of receptor | CD24 |
| Type of receptor | PRR |
| Source | Human |
| Localization | NA |
| Domain | NA |
| Sequence of Receptor | P25063.fasta |
| Swiss prot ID | P25063 |
| Length Of Receptor | 80 |
| Function | Activate NF-KB |
| Assay used | NA |
| PMID | 28049142 |
| Year of Publication | 2017 |
| Pubchem assay | NA |
| Pdb | PRR_0003.pdb |
| 3-D Structure | PRR_0003 (View) or (Download) |