Browse result page of CPPsite 2.0
The total number entries retrieved from this search are 714| ID | PEPTIDE SEQUENCE | PEPTIDE NAME | LENGTH | CHIRALITY | LINEAR/CYCLIC | SOURCE | CATEGORY | N TERMINAL MODIFICATION | C TERMINAL MODIFICATION | CHEMICAL MODIFICATION | CARGO | PUBMED ID |
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 2190 | KCFQWQRNMRKVRGPPVSCIKR | hLF R7 | 22 | L | Linear | Protein derived | Cationic | Conjugation with 5(6)-Carboxyfluorescein | Amidation | NA | Fluorophore (Fluorescein) | 24270856 |
| 2191 | KCFQWQRNMRKVRGPPVSCIKR | hLF K7 | 22 | L | Linear | Protein derived | Cationic | Conjugation with 5(6)-Carboxyfluorescein | Amidation | NA | Fluorophore (Fluorescein) | 24270856 |
| 2192 | K-Hey-FQWQRNMRKVRGPPVS-Hey-IKR | hLF Hcy | 20 | Modified | Linear | Protein derived | Cationic | Conjugation with 5(6)-Carboxyfluorescein | Amidation | hcy, homocysteine in which the side chain is one methylene group longer than in cysteine | Fluorophore (Fluorescein) | 24270856 |
| 2193 | GRGDSPRR | Pep1 | 8 | L | Linear | Synthetic | Cationic | Acetylation | Free | Phosphorylation | Nucleic acid (Plasmid DNA) | 24462902 |
| 2194 | GRGDSPRRSPRR | Pep2 | 12 | L | Linear | Synthetic | Cationic | Acetylation | Free | Phosphorylation | Nucleic acid (Plasmid DNA) | 24462902 |
| 2195 | GRGDSPRRKKKKSPRRKKKKSPRR | Pep3 | 24 | L | Linear | Synthetic | Cationic | Acetylation | Free | Phosphorylation | Nucleic acid (Plasmid DNA) | 24462902 |
| 2196 | GRGDGPRRKKKKGPRRKKKKGPRR | Pep3(Mutant) | 24 | L | Linear | Synthetic | Cationic | Acetylation | Free | NA | Nucleic acid (Plasmid DNA) | 24462902 |
| 2208 | RRRRRRRRR | R9 | 9 | L | Linear | Synthetic | Cationic | Free | Free | NA | Nanoparticle (PMS labelled with the fluorescent probe di-4-ANEPPDHQ) | 24583633 |
| 2215 | IPLVVPLRRRRRRRRC | RIPL | 16 | L | Linear | Chimeric | Cationic | Free | Free | RIPL peptides is conjugated to maleimide-derivatized liposomal vesicles via the thiol-maleimide reaction | Fluorophore (FITC) | 24704199 |
| 2216 | RRRRRRRRC | R8 | 9 | L | Linear | Synthetic | Cationic | Free | Free | NA | Fluorophore (FITC) | 24704199 |
| 2218 | KFLNRFWHWLQLKPGQPMY | IP-1 | 19 | L | Linear | Synthetic | Cationic | Free | Free | NA | Fluorophore (Hilytefluor 488 and TAMARA) | 24706763 |
| 2219 | KFLNRFWHWLQLKPGQPMY | TAMRA-IP-1 | 19 | L | Linear | Synthetic | Cationic | Free | Free | NA | Fluorophore (TAMRA) | 24706763 |
| 2220 | KFLNRFWHWLQLKPGQPMY | Hilytefluor 488-IP-1 | 19 | L | Linear | Synthetic | Cationic | Free | Free | NA | Fluorophore (Hilyteflour) | 24706763 |
| 2221 | YGRKKRRQRRR | EGFP-TAT | 11 | L | Linear | Protein derived | Cationic | Conjugated with EGFP | Free | NA | Protein (eGFP) | 24746937 |
| 2222 | RQIKIWFQNRRMKWKK | EGFP-Antp | 16 | L | Linear | Protein derived | Cationic and amphipathic | Conjugated with EGFP | Free | NA | Protein (eGFP) | 24746937 |
| 2225 | GSVSRRRRRRGGRRRR | EGFP-LMWP | 16 | L | Linear | Protein derived | Cationic | Conjugated with EGFP | Free | NA | Protein (eGFP) | 24746937 |
| 2230 | RRRRRRRRRRRR | EGFP-R12 | 12 | L | Linear | Synthetic | Cationic | Conjugated with EGFP | Free | NA | Protein (eGFP) | 24746937 |
| 2232 | YARVRRRGPRR | Hph-1 | 11 | L | Linear | Synthetic | Cationic | Conjugation with 6-histidine tag | Free | NA | Nucleic acid (Hph1Hph1dsRBD/FAM-labeled siRNA complex) | 24768403 |
| 2233 | CRQIKIWFQNRRMKWKK | Penetratin | 17 | L | Linear | Protein derived | Cationic and amphipathic | Acetylation | Amidation | NA | Peptide (KLA) and Nanoparticle (DSPC and DSPG liposomes) | 24796502 |
| 2239 | RKKNPNCRRH | hBCPP | 10 | L | Linear | Protein derived | Cationic | Free | Free | NA | Peptide (Smurf1-binding peptide) | 24831974 |
| 2242 | GRKKRRQRRRPPQY | Tat-Dex | 14 | L | Cyclic | Protein derived | Cationic | Free | Amidation | Dexamethasone | Dexamethasone | 24896852 |
| 2248 | RRRRRRRRR | R9-PCP | 9 | L | Linear | Synthetic | Cationic | Acetylation | Amidation | Φ, L-2-naphthylalanine,miniPEG, 8-amino-3,6-dioxaoctanoic acid | Peptide [PCP, miniPEG-DE(pCAP)LI-NH2] | 24896852 |
| 2249 | RKKRRQRRR | Tat-PCP | 9 | L | Linear | Protein derived | Cationic | Acetylation | Amidation | Φ, L-2-naphthylalanine,miniPEG, 8-amino-3,6-dioxaoctanoic acid | Peptide [PCP, miniPEG-DE(pCAP)LI-NH2] | 24896852 |
| 2250 | RQIKIWFQNRRMKWKK | Antp-PCP | 16 | L | Linear | Protein derived | Cationic and amphipathic | Acetylation | Amidation | Φ, L-2-naphthylalanine,miniPEG, 8-amino-3,6-dioxaoctanoic acid | Peptide [PCP, miniPEG-DE(pCAP)LI-NH2] | 24896852 |
| 2257 | RRIRPRPPRLPRPRPRPLPFPRPG | Bac-ELP43 | 24 | L | Linear | Synthetic | Cationic | Free | Free | NA | Peptide [ELP (Elastin like peptide sequence), Fluorophore (Alexa-Fluor)] | 24866938 |
| 2258 | RRIRPRPPRLPRPRPRPLPFPRPG | Bac-ELP63 | 24 | L | Linear | Synthetic | Cationic | Free | Free | NA | Peptide [ELP (Elastin like peptide sequence), Fluorophore (Alexa-Fluor)] | 24866938 |
| 2259 | RRIRPRPPRLPRPRPRPLPFPRPG | Bac-ELP122 | 24 | L | Linear | Synthetic | Cationic | Free | Free | NA | Peptide [ELP (Elastin like peptide sequence), Fluorophore (Alexa-Fluor)] | 24866938 |
| 2264 | PKKKRKV-AGYLLGKINLKALAALAKKIL-PQMQQNVFQYPGAGMVPQGEANF | TP10-SRC1LXXLL | 51 | L | Linear | Chimeric | Cationic | Conjugated with NLS | Free | NA | Fluorophore (FITC ) | 24705462 |
| 2265 | PKKKRKV-RRRRRRR-YSQTSHKLVQLLTTAEQQ | R7-SRC1LXXLL | 32 | L | Linear | Synthetic | Cationic | Conjugated with NLS | Free | NA | Fluorophore (FITC ) | 24705462 |
| 2266 | PKKKRKV-AGYLLGKINLKALAALAKKIL-PQMQQNVFQYPGAGMVPQGEANF | TP10-SRC1(1222-1245) | 51 | L | Linear | Chimeric | Cationic | Conjugated with NLS | Free | NA | Fluorophore (FITC ) | 24705462 |
| 2267 | PKKKRKV-RRRRRRR-PQMQQNVFQYPGAGMVPQGEANF | R7-SRC1(1222-1245) | 37 | L | Linear | Synthetic | Cationic | Conjugated with NLS | Free | NA | Fluorophore (FITC ) | 24705462 |
| 2291 | YGRKKRRQRRR | P42-TAT | 11 | L | Linear | Protein derived | Cationic | Free | Free | NA | P42-TAT incorporated in a water-in-oil microemulsion | 25091984 |
| 2292 | RRRRRRRR | F(SG)4R8 | 8 | L | Linear | Synthetic | Cationic | Acetylation | Amidation | NA | Fluorophore (Alexa488), Protein (bovine serum albumin) and Nanoparticle (quantum dots) | 25108152 |
| 2293 | RRRRRRRR | G(SG)4R8 | 8 | L | Linear | Synthetic | Cationic | Acetylation | Amidation | NA | Fluorophore (Alexa488), Protein (bovine serum albumin) and Nanoparticle (quantum dots) | 25108152 |
| 2294 | RQIKIWFQNRRMKWKK | F(SG)4Pen | 16 | L | Linear | Protein derived | Cationic and amphipathic | Acetylation | Amidation | NA | Fluorophore (Alexa488), Protein (bovine serum albumin) and Nanoparticle (quantum dots) | 25108152 |
| 2295 | RQIKIWFQNRRMKWKK | G(SG)4Pen | 16 | L | Linear | Protein derived | Cationic and amphipathic | Acetylation | Amidation | NA | Fluorophore (Alexa488), Protein (bovine serum albumin) and Nanoparticle (quantum dots) | 25108152 |
| 2299 | YGRKKRRQRRRDPYHATSGALSPAKDCGSQKYAYFNGCSSPTLSPMSP | PEP-1 | 48 | L | Linear | Synthetic | Cationic | Free | Free | NA | NA | 24457967 |
| 2300 | YGRKKRRQRRRAYFNGCSSPTAPLSPMSP | PEP-2 | 29 | L | Linear | Synthetic | Cationic | Free | Free | NA | NA | 24457967 |
| 2301 | YGRKKRRQRRRQRRRPTAPLSPMSP | PEP-3 | 25 | L | Linear | Synthetic | Cationic | Free | Free | NA | NA | 24457967 |
| 2303 | CGGKDCERRFSRSDQLKRHQRRHTGVKPFQ | b-WT1-pTj | 30 | L | Linear | Protein derived | Cationic | Biotinylation | Amidation | NA | Biotin | 24490140 |
| 2304 | KDCERRFSRSDQLKRHQRRHTGVKPFQK | FITC-WT1-pTj | 28 | L | Linear | Protein derived | Cationic | Free | NA | NA | Fluorophore (FITC) | 24490140 |
| 2307 | RRRRRRR | R7 | 7 | L | Linear | Synthetic | Cationic | Free | Free | NA | Protein (ESRRB recombinant protein) | 24693491 |
| 2308 | GGGGRRRRRRRRRLLLL | m9R | 17 | L | Linear | Synthetic | Cationic | Maleimide addition | Free | NA | Protein (Cas9) | 24696462 |
| 2309 | CGGGRRRRRRRRRLLLL | sgRNA-CPP | 17 | L | Linear | Synthetic | Cationic | Free | Free | NA | Nucleic acid (sgRNA) | 24696462 |
| 2311 | YGRKKRRQRRR | TAT(47-57) | 11 | L | Linear | Protein derived | Cationic | Free | Free | NA | Peptide (Mitochondrial Target Domain of NOXA) | 24416126 |
| 2312 | RQIKIWFQNRRMKWKK | Penetratin | 16 | L | Linear | Protein derived | Cationic and amphipathic | Free | Free | NA | Peptide (Mitochondrial Target Domain of NOXA) | 24416126 |
| 2316 | RRRRRRRRR | R9 | 9 | L | Linear | Synthetic | Cationic | Biotinylation | Amidation | NA | Biotin-gly4 | 25112713 |
| 2317 | YGRKKRRQRRR | TAT(47-57) | 11 | L | Linear | Protein derived | Cationic | Biotinylation | Amidation | NA | Biotin-gly4 | 25112713 |
| 2318 | RRLLRRLRR | R6L3 | 9 | L | Linear | Synthetic | Cationic | Biotinylation | Amidation | NA | Biotin-gly4 | 25112713 |
| 2319 | RQIKIWFQNRRMKWKK | Penetratin | 16 | L | Linear | Protein derived | Cationic and amphipathic | Biotinylation | Amidation | NA | Biotin-gly4 | 25112713 |