ID | PEPTIDE SEQUENCE | PEPTIDE NAME | LENGTH | CHIRALITY | LINEAR/CYCLIC | SOURCE | CATEGORY | N TERMINAL MODIFICATION | C TERMINAL MODIFICATION | CHEMICAL MODIFICATION | CARGO | PUBMED ID |
---|---|---|---|---|---|---|---|---|---|---|---|---|
2559 | GRKKRRQRRR | Gd3+-DOTA-CAT | 10 | L | Linear | Protein derived | Cationic | Conjugated with Gd³⁺-DOTA via CAT recognition site | Free | NA | MRI probe [DOTA-caged metal ion (Gd³?)] | 23281285 |
2563 | YGRKKRRQRRR | TAT-EGFP | 11 | L | Linear | Protein derived | Cationic | Conjugation with EGFP | Free | NA | Protein (eGFP) | 24746937 |
2564 | RQIKIWFQNRRMKWKK | Antp-EGFP | 16 | L | Linear | Protein derived | Cationic and amphipathic | Conjugation with EGFP | Free | NA | Protein (eGFP) | 24746937 |
2565 | DAATARGRGRSAASRPTERPRAPARSASRPRRPVD | VP-22-EGFP | 35 | L | Linear | Protein derived | Amphipathic | Conjugation with EGFP | Free | NA | Protein (eGFP) | 24746937 |
2566 | LLIILRRRIRKQAHAHSK | pVEC-EGFP | 18 | L | Linear | Protein derived | Amphipathic | Conjugation with EGFP | Free | NA | Protein (eGFP) | 24746937 |
2567 | GSVSRRRRRRGGRRRR | LMWP-EGFP | 16 | L | Linear | Protein derived | Cationic | Conjugation with EGFP | Free | NA | Protein (eGFP) | 24746937 |
2568 | LGTYTQDFNKFHTFPQTAIGVGAP | hcT(9-32)-EGFP | 24 | L | Linear | Protein derived | Amphipathic | Conjugation with EGFP | Free | NA | Protein (eGFP) | 24746937 |
2580 | CKYGRKKRRQRRR | fTAT | 13 | L | Linear | Protein derived | Cationic | Extra Cys and Lys added for labeling of TMR | Free | NA | Fluorophore (TMR) | 24930129 |
2581 | RRRQRRKKRGYCKCKYGRKKRRQRRR | dfTAT | 26 | L | Linear | Protein derived | Cationic | Extra Cys and Lys added for labeling of TMR and dimerization | Free | NA | Protein (eGFP), Fluorophore (TMR) | 24930129 |
2582 | CKYGRKKRRQRRR | acFTAT | 13 | L | Linear | Protein derived | Cationic | Acetamidation | Free | NA | Fluorophore (TMR) | 24930129 |
2583 | RRRQRRKKRGYCKCKYGRKKRRQRRR | nrdfTAT | 26 | L | Linear | Protein derived | Cationic | bis(maleimido)ethane added | Free | NA | Fluorophore (TMR) | 24930129 |
2584 | AYGRKKRRQRRR | DOX-TAT-LIP | 12 | L | Linear | Protein derived | Cationic | Cysteine addition | Free | NA | Nanaoparticle (Liposome), Small molecule drug (Doxorubicin) | 24893333 |
2585 | AYGRKKRRQRRR | DOX-T7-TAT-LIP | 12 | L | Linear | Protein derived | Cationic | Cysteine addition | Free | NA | Nanoparticle (Liposome), Small molecule drug (Doxorubicin), protein (Transferin) | 24893333 |
2587 | RQIKIQFQNRRKWKK | Antennapedia | 15 | L | Linear | Protein derived | Cationic | Free | Free | NA | Protein (His-tagged Cre protein) | 24753043 |
2589 | GRKKRRQRRRPPQ | HIV-TAT | 13 | L | Linear | Protein derived | Cationic | Free | Free | NA | Sodium diclofenac (Na-DFC), Small molecule drug [celecoxib (CLXB)] | 24798650 |
2590 | AYGRKKRRQRRR | TAT-cysteine peptide | 12 | L | Linear | Protein derived | Cationic | Free | Free | NA | Nanoparticle (Liposomes) | 24709209 |
2591 | GNYAHRVGAGAPVWL | HipC | 15 | L | Linear | Protein derived | NA | Free | Free | NA | NA | 24747525 |
2592 | TVDNPASTTNKDKLFAVRK | VP1 BC loop (V) peptides | 19 | L | Linear | Protein derived | NA | Free | Free | NA | Protein (Calcetonin) | 23802147 |
2593 | GRKKRRQRRRPPQRKC | TAT | 16 | L | Linear | Protein derived | Cationic | Free | Free | NA | Protein (Calcetonin) | 23802147 |
2596 | YGRKKRRQRRR | fTat | 11 | L | Linear | Protein derived | Cationic | Conjugation with 5(6)-Carboxyfluorescein | Free | NA | Fluorophore (Carboxyflouresein) | 24657280 |
2597 | CCTGRKKRRQRRR | TAT | 13 | L | Linear | Protein derived | Cationic | Free | Free | NA | Nanoparticle | 24736021 |
2599 | GGAYVTRSSAVRLRSSVPGVRLLQ | CF-Vim-TBS.58-81 | 24 | L | Linear | Protein derived | NA | Conjugation with 5(6)-Carboxyfluorescein | Amidation | NA | Fluorophore (Carboxyfluorescein) | 21575694 |
2600 | GRKKRRQRRRPPQ | CF-Tat.48-60 | 13 | L | Linear | Protein derived | NA | Conjugation with 5(6)-Carboxyfluorescein | Amidation | NA | Fluorophore (Carboxyfluorescein) | 21575694 |
2610 | RKKRRQRRR | TAT | 9 | L | Linear | Protein derived | Cationic | NA | NA | NA | Nucleic acid (Calcium comlexed siRNA) | 21856394 |
2613 | LLIILRRRIRKQAHAHSK | pVEC | 18 | L | Linear | Protein derived | Amphipathic | NA | NA | NA | Nucleic acid (Plasmid DNA) | 21996011 |
2639 | YKQCHKKGGHCFPKEKICLPPSSDFGKMDCRWRWKCCKKGSG | Crotamine | 42 | L | Linear | Protein derived | NA | NA | NA | NA | Fluorophore (Alexa 700) | 22142367 |
2648 | CAYGRKKRRQRRR | TAT | 13 | L | Linear | Protein derived | Cationic | Cysteine addition | NA | NA | Nanoparticle (Liposomes) | 22188312 |
2660 | RQIKIWFQNRRMKWKK | Penetratin | 16 | L | Linear | Protein derived | Cationic and amphipathic | NA | NA | NA | Nucleic acid (Plasmid DNA) | 22281502 |
2661 | RQIKIWFQNRRMKWKKC | Pen-Cys | 17 | L | Linear | Protein derived | Cationic and amphipathic | NA | NA | Cysteine modification | Nucleic acid (Plasmid DNA) | 22281502 |
2677 | GRKKRRQRRR | Tat | 10 | L | Linear | Protein derived | Cationic | Conjugation with fluorescein | NA | NA | Fluorophore (Fluorescein) | 22413929 |
2679 | YGRKKRRQRRR | Tat | 11 | L | Linear | Protein derived | Cationic | NA | NA | NA | Nucleic acid (siRNA) | 22452378 |
2712 | GCGGGYGRKKRRQRRR | Tat | 16 | L | Linear | Protein derived | Cationic | NA | NA | NA | Nanoparticle | 22531849 |
2718 | CGGGYGRKKRRQRRR | AgNP-TAT | 15 | L | Linear | Protein derived | Cationic | NA | NA | NA | Nanosilver Nanoparticles | 22682937 |
2727 | YKQCHKKGGHCFPKEKICLPPSSDFGKMDCRWRWKCCKKGSG | Crotamine | 42 | L | Linear | Protein derived | NA | NA | NA | NA | Nucleic acid | 22791447 |
2728 | YGRKKRPQRRR | 1 (TAT) | 11 | L | Linear | Protein derived | Cationic | NA | NA | NA | Fluorophore (FITC) | 22805558 |
2757 | RQIKIWFQNRRMKWKK | penetratin | 16 | L | Linear | Protein derived | Cationic and amphipathic | NA | NA | PEGylation | Nanoparticle (PEG-PLA) | 22841849 |
2772 | RQIKIWFQNRRMKWKK | Penetratin | 16 | L | Linear | Protein derived | Cationic and amphipathic | Free | Free | NA | Protein (Single-Chain Antibody) | 23160949 |
2773 | CALNN-YGRKKRRQRRR | Tat | 16 | L | Linear | Protein derived | Cationic | Free | Free | NA | Nanoparticle (Quantum dots) | 23184894 |
2804 | AYLLGKINLKALAALAKKIL | TP10 | 20 | L | Linear | Protein derived | Amphipathic | Conjugation with 5(6)-Carboxyfluorescein | Amidation | NA | Fluorophore [5(6)-carboxyfluorescein] | 23669260 |
2805 | A-CF3-Bpg-LYLLGKINLKALAALAKKIL | TP10 2GL | 21 | Modified | Linear | Protein derived | Amphipathic | Conjugation with 5(6)-Carboxyfluorescein | Amidation | L-CF3-Bpg, Trifluoromethyl- bicyclopent-[1.1.1]-1-ylglycine | Fluorophore [5(6)-carboxyfluorescein] | 23669260 |
2806 | AGY-CF3-Bpg-LGKINLKALAALAKKIL | TP10 4LL | 20 | Modified | Linear | Protein derived | Amphipathic | Conjugation with 5(6)-Carboxyfluorescein | Amidation | L-CF3-Bpg, Trifluoromethyl- bicyclopent-[1.1.1]-1-ylglycine | Fluorophore [5(6)-carboxyfluorescein] | 23669260 |
2807 | a-CF3-Bpg-lyllgkinlkalaalakkil | TP10 2GD | 21 | Modified | Linear | Protein derived | Amphipathic | Conjugation with 5(6)-Carboxyfluorescein | Amidation | L-CF3-Bpg, Trifluoromethyl- bicyclopent-[1.1.1]-1-ylglycine | Fluorophore [5(6)-carboxyfluorescein] | 23669260 |
2808 | agy-CF3-Bpg-lgkinlkalaalakkil | TP10 4LD | 20 | Modified | Linear | Protein derived | Amphipathic | Conjugation with 5(6)-Carboxyfluorescein | Amidation | L-CF3-Bpg, Trifluoromethyl- bicyclopent-[1.1.1]-1-ylglycine | Fluorophore [5(6)-carboxyfluorescein] | 23669260 |
2816 | GRKKRRQRRRPPQ | Tat (48-60) | 13 | L | Linear | Protein derived | Cationic | Conjugation with rhodamine B | Free | NA | Fluorophore (Rhodamine B) | 23707662 |
2817 | GRKKRRQRRRPPQRKC | Tat | 16 | L | Linear | Protein derived | Cationic | Free | Free | NA | Protein [synthetic salmon CT (sCT)] | 23802147 |
2818 | GRKKRRERRRPPERKCX | Tat | 17 | L | Linear | Protein derived | Cationic | Free | Free | NA | Peptide [VP1 BC loop (V) peptides] | 23802147 |
2820 | EARPALLTSRLRFIPK | GV1001 | 16 | L | Linear | Protein derived | NA | Free | Free | NA | Protein (eGFP) | 23827187 |
2822 | GRKKRRQRRR | Tat (TG) | 10 | L | Linear | Protein derived | Cationic | NA | NA | NA | Protein (GFP, anti-oxidative metallothionein protein) | 23871961 |
2823 | GRKKRRQRRRMVSAL | TatsMTS (TMG) | 15 | L | Linear | Protein derived | Cationic | NA | NA | NA | Protein (GFP, anti-oxidative metallothionein protein) | 23871961 |
2824 | TPWWRLWTKWHHKRRDLPRKPEGC | FITC-Rath | 24 | L | Linear | Protein derived | NA | NA | Free | NA | Fluorophore (FITC) | 23937069 |