Browse result page of AntiTbPdb
The total number entries retrieved from this search are 434
| ID | Name | Sequence | N-Terminal Modification | C-Terminal Modification | Chemical Modification | Linear/Cyclic | Length | Chirality | Nature | Source | Origin | Species | Strain | Inhibition Concentration | In vitro/ In vivo | Cell Line | Intracellular Inhibition | Cytotoxicity | Animal Model | Effective Dose in model organism | Immune Responce | Mechanism of Action | Target | Combination Therapy | Other Activities | Year of Publication | Pubmed ID/ Patent No. |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| antitb_1334 | Cairomycin B | not available | NA | NA | NA | Cyclic | 0 | Mix | NA | Natural | Streptomyces fungus | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC= 50 μg/mL | Both | NA | NA | NA | Swiss mice | 3 mg/kg of body weight | NA | NA | NA | NA | Antimicrobial against S.aureus, B.subtilis, P.aureginosa,Pseudomonas. Antifungal also. | 1976 | 855995 |
| antitb_1335 | Dihydromycoplanecin A | R-N(CH3)-CH(CH-CH3-CH3)-CO-N(CH-C-CH2-CH3-C-CH)-CO-N(CH3)-CH-C)-NH-CH(CH2-CH-CH3-CH3)-CO-N-CH-C-CH3_C-CH)-CONH-CH(CH2-CH2-CH-CH3-CH3)-Co-N-CH3-Ch-CH(CH3-CH3)-Co-N-(CH-C-Ch)-Co-N(CH3)-CH(CH2-CH-CH3-CH3)-CO-NH-CH2-CO-O-CH(CH3) | Propanol is attached | Free | R =CH3-CH2-CH(OH)-CO | Cyclic | 21 | Mix | NA | Natural | Aspergillus awajinensis | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | IC50 = <0.0125 μg/mL (50%) | Both | NA | NA | NA | ICR/JCL male mice and male beagle dogs | 10 mg/kg for mice and 50mg/kg for dog | NA | NA | NA | NA | NA | 1988 | 3348603 |
| antitb_1336 | Dihydromycoplanecin A | R-N(CH3)-CH(CH-CH3-CH3)-CO-N(CH-C-CH2-CH3-C-CH)-CO-N(CH3)-CH-C)-NH-CH(CH2-CH-CH3-CH3)-CO-N-CH-C-CH3_C-CH)-CONH-CH(CH2-CH2-CH-CH3-CH3)-Co-N-CH3-Ch-CH(CH3-CH3)-Co-N-(CH-C-Ch)-Co-N(CH3)-CH(CH2-CH-CH3-CH3)-CO-NH-CH2-CO-O-CH(CH3) | Propanol is attached | Free | R =CH3-CH2-CH(OH)-CO | Cyclic | 21 | Mix | NA | Natural | Aspergillus awajinensis | Mycobacterium intracellulare | Mycobacterium intracellulare | IC50 = 1.56 μg/mL (50%) | Both | NA | NA | NA | ICR/JCL male mice and male beagle dogs | 11 mg/kg for mice and 50mg/kg for dog | NA | NA | NA | NA | NA | 1988 | 3348603 |
| antitb_1337 | Dihydromycoplanecin A | R-N(CH3)-CH(CH-CH3-CH3)-CO-N(CH-C-CH2-CH3-C-CH)-CO-N(CH3)-CH-C)-NH-CH(CH2-CH-CH3-CH3)-CO-N-CH-C-CH3_C-CH)-CONH-CH(CH2-CH2-CH-CH3-CH3)-Co-N-CH3-Ch-CH(CH3-CH3)-Co-N-(CH-C-Ch)-Co-N(CH3)-CH(CH2-CH-CH3-CH3)-CO-NH-CH2-CO-O-CH(CH3) | Propanol is attached | Free | R =CH3-CH2-CH(OH)-CO | Cyclic | 21 | Mix | NA | Natural | Aspergillus awajinensis | Mycobacterium kansasii | Mycobacterium kansasii | IC50= 0.39 μg/mL (50%) | Both | NA | NA | NA | ICR/JCL male mice and male beagle dogs | 12 mg/kg for mice and 50mg/kg for dog | NA | NA | NA | NA | NA | 1988 | 3348603 |
| antitb_1338 | Dihydromycoplanecin A | R-N(CH3)-CH(CH-CH3-CH3)-CO-N(CH-C-CH2-CH3-C-CH)-CO-N(CH3)-CH-C)-NH-CH(CH2-CH-CH3-CH3)-CO-N-CH-C-CH3_C-CH)-CONH-CH(CH2-CH2-CH-CH3-CH3)-Co-N-CH3-Ch-CH(CH3-CH3)-Co-N-(CH-C-Ch)-Co-N(CH3)-CH(CH2-CH-CH3-CH3)-CO-NH-CH2-CO-O-CH(CH3) | Propanol is attached | Free | R =CH3-CH2-CH(OH)-CO | Cyclic | 21 | Mix | NA | Natural | Aspergillus awajinensis | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | IC90= 0.05 μg/mL(90%) | Both | NA | NA | NA | ICR/JCL male mice and male beagle dogs | 13 mg/kg for mice and 50mg/kg for dog | NA | NA | NA | NA | NA | 1988 | 3348603 |
| antitb_1339 | Dihydromycoplanecin A | R-N(CH3)-CH(CH-CH3-CH3)-CO-N(CH-C-CH2-CH3-C-CH)-CO-N(CH3)-CH-C)-NH-CH(CH2-CH-CH3-CH3)-CO-N-CH-C-CH3_C-CH)-CONH-CH(CH2-CH2-CH-CH3-CH3)-Co-N-CH3-Ch-CH(CH3-CH3)-Co-N-(CH-C-Ch)-Co-N(CH3)-CH(CH2-CH-CH3-CH3)-CO-NH-CH2-CO-O-CH(CH3) | Propanol is attached | Free | R =CH3-CH2-CH(OH)-CO | Cyclic | 21 | Mix | NA | Natural | Aspergillus awajinensis | Mycobacterium intracellulare | Mycobacterium intracellulare | IC90= 0.78 μg/mL(90%) | Both | NA | NA | NA | ICR/JCL male mice and male beagle dogs | 14 mg/kg for mice and 50mg/kg for dog | NA | NA | NA | NA | NA | 1988 | 3348603 |
| antitb_1340 | Dihydromycoplanecin A | R-N(CH3)-CH(CH-CH3-CH3)-CO-N(CH-C-CH2-CH3-C-CH)-CO-N(CH3)-CH-C)-NH-CH(CH2-CH-CH3-CH3)-CO-N-CH-C-CH3_C-CH)-CONH-CH(CH2-CH2-CH-CH3-CH3)-Co-N-CH3-Ch-CH(CH3-CH3)-Co-N-(CH-C-Ch)-Co-N(CH3)-CH(CH2-CH-CH3-CH3)-CO-NH-CH2-CO-O-CH(CH3) | Propanol is attached | Free | R =CH3-CH2-CH(OH)-CO | Cyclic | 21 | Mix | NA | Natural | Aspergillus awajinensis | Mycobacterium kansasii | Mycobacterium kansasii | IC90= 0.78 μg/mL(90%) | Both | NA | NA | NA | ICR/JCL male mice and male beagle dogs | 15 mg/kg for mice and 50mg/kg for dog | NA | NA | NA | NA | NA | 1988 | 3348603 |
| antitb_1341 | Dihydromycoplanecin A | R-N(CH3)-CH(CH-CH3-CH3)-CO-N(CH-C-CH2-CH3-C-CH)-CO-N(CH3)-CH-C)-NH-CH(CH2-CH-CH3-CH3)-CO-N-CH-C-CH3_C-CH)-CONH-CH(CH2-CH2-CH-CH3-CH3)-Co-N-CH3-Ch-CH(CH3-CH3)-Co-N-(CH-C-Ch)-Co-N(CH3)-CH(CH2-CH-CH3-CH3)-CO-NH-CH2-CO-O-CH(CH3) | Propanol is attached | Free | R =CH3-CH2-CH(OH)-CO | Cyclic | 21 | Mix | NA | Natural | Aspergillus awajinensis | Mycobacterium bovis | Mycobacterium tuberculosis H37Rv | NA | Both | NA | NA | NA | ICR/JCL Mice | 15 mg/kg for mice and 50mg/kg for dog | NA | NA | NA | 4mg of DHMPA peptide+ 0.1 mg of Isoniazid | NA | 1988 | 3348603 |
| antitb_1342 | Dihydromycoplanecin A | R-N(CH3)-CH(CH-CH3-CH3)-CO-N(CH-C-CH2-CH3-C-CH)-CO-N(CH3)-CH-C)-NH-CH(CH2-CH-CH3-CH3)-CO-N-CH-C-CH3_C-CH)-CONH-CH(CH2-CH2-CH-CH3-CH3)-Co-N-CH3-Ch-CH(CH3-CH3)-Co-N-(CH-C-Ch)-Co-N(CH3)-CH(CH2-CH-CH3-CH3)-CO-NH-CH2-CO-O-CH(CH3) | Propanol is attached | Free | R =CH3-CH2-CH(OH)-CO | Cyclic | 21 | Mix | NA | Natural | Aspergillus awajinensis | Mycobacterium tuberculosis | Mycobacterium tuberculosis R-KM | NA | Both | NA | NA | NA | ICR/JCL Mice | 15 mg/kg for mice and 50mg/kg for dog | NA | NA | NA | 4mg of DHMPA peptide+ 0.1 mg of Isoniazid | NA | 1988 | 3348603 |
| antitb_1343 | Dihydromycoplanecin A | R-N(CH3)-CH(CH-CH3-CH3)-CO-N(CH-C-CH2-CH3-C-CH)-CO-N(CH3)-CH-C)-NH-CH(CH2-CH-CH3-CH3)-CO-N-CH-C-CH3_C-CH)-CONH-CH(CH2-CH2-CH-CH3-CH3)-Co-N-CH3-Ch-CH(CH3-CH3)-Co-N-(CH-C-Ch)-Co-N(CH3)-CH(CH2-CH-CH3-CH3)-CO-NH-CH2-CO-O-CH(CH3) | Propanol is attached | Free | R =CH3-CH2-CH(OH)-CO | Cyclic | 21 | Mix | NA | Natural | Aspergillus awajinensis | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC 607 | FIC= 0.250 - 0.375 | NA | NA | NA | NA | NA | NA | NA | NA | NA | DHMPA+ Isoniazid | NA | 1988 | 3348603 |
| antitb_1344 | Tenecin 1 fragment 1-15 | VTCDILSVEAKGVKL | Free | Amidation | None | Linear | 15 | NA | NA | Natural | Larvae of tenebrio molitor(beetle) | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC 607 | MIC = >100 μg/ml | in vitro | Human erythrocyte | NA | None | NA | NA | NA | Membrane disruption as reported by membrane leaky assay | NA | NA | None | 1998 | 9693108 |
| antitb_1345 | Tenecin 1 fragment 17-27 | DAACAAHCLFR | Free | Amidation | Internal disulphide bond | Cyclic | 11 | NA | NA | Natural | Larvae of tenebrio molitor(beetle) | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC 608 | MIC = >100 μg/ml | in vitro | Human erythrocyte | NA | None | NA | NA | NA | Membrane disruption as reported by membrane leaky assay | NA | NA | None | 1998 | 9693108 |
| antitb_1346 | Tenecin 1 fragment 16-32 | DAACAAHCLFR | Free | Amidation | None | Linear | 11 | NA | NA | Natural | Larvae of tenebrio molitor(beetle) | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC 609 | MIC = >100 μg/ml | in vitro | Human erythrocyte | NA | None | NA | NA | NA | Membrane disruption as reported by membrane leaky assay | NA | NA | NA | 1998 | 9693108 |
| antitb_1347 | Tenecin 1 fragment 29-43 | NDAACAAHCLFRGRSGG | Free | Amidation | None | Linear | 17 | NA | NA | Natural | Larvae of tenebrio molitor(beetle) | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC 610 | MIC = >100 μg/ml | in vitro | Human erythrocyte | NA | None | NA | NA | NA | Membrane disruption as reported by membrane leaky assay | NA | NA | Antibacterial against MRSA, bacillus subtilis, E.coli, Shigella at 10-30 μg/ml | 1998 | 9693108 |
| antitb_1348 | Tenecin 1 Fragment 33-42 | RSGGYCNGKRVCVCR | Free | Amidation | None | Linear | 15 | NA | NA | Natural | Larvae of tenebrio molitor(beetle) | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC 611 | MIC = >100 μg/ml | in vitro | Human erythrocyte | NA | None | NA | NA | NA | Membrane disruption as reported by membrane leaky assay | NA | NA | Antibacterial against MRSA, bacillus subtilis, E.coli, Shigella at 10-30 μg/ml | 1998 | 9693108 |
| antitb_1349 | Tenecin 1 Fragment 33-43 | YCNGKRVCVC | Free | Amidation | Internal disulphide bond | Cyclic | 10 | NA | NA | Natural | Larvae of tenebrio molitor(beetle) | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC 612 | MIC = >100 μg/ml | in vitro | Human erythrocyte | NA | None | NA | NA | NA | Membrane disruption as reported by membrane leaky assay | NA | NA | Antibacterial against MRSA, bacillus subtilis, E.coli, Shigella at 10-30 μg/ml | 1998 | 9693108 |
| antitb_1350 | Tenecin 1 Fragment 34-43 | YCNGKRVCVCR | Free | Amidation | None | Linear | 11 | NA | NA | Natural | Larvae of tenebrio molitor(beetle) | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC 613 | MIC = >100 μg/ml | in vitro | Human erythrocyte | NA | Cytotoxic at >10 μg/ml | NA | NA | NA | Membrane disruption as reported by membrane leaky assay | NA | NA | None | 1998 | 9693108 |
| antitb_1351 | Tenecin 1 Fragment 35-43 | CNGKRVCVCR | Free | Amidation | None | Linear | 10 | NA | NA | Natural | Larvae of tenebrio molitor(beetle) | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC 614 | MIC = >100 μg/ml | in vitro | Human erythrocyte | NA | None | NA | NA | NA | Membrane disruption as reported by membrane leaky assay | NA | NA | None | 1998 | 9693108 |
| antitb_1352 | Tenecin 1 Fragment 34-42 | NGKRVCVCR | Free | Amidation | None | Linear | 9 | NA | NA | Natural | Larvae of tenebrio molitor(beetle) | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC 615 | MIC = >100 μg/ml | in vitro | Human erythrocyte | NA | None | NA | NA | NA | NA | NA | NA | None | 1998 | 9693108 |
| antitb_1354 | Nk-lysin | NEDTVTQAASRVCDKMKILRGVCKKIMRTFLRRISKD | Free | Free | Internal disuphide bond 13 -23 | Cyclic | 37 | L | NA | Natural | Pig cytolytic lymphocytes | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv ATCC 25618 | IC90 = 30 μM | In vitro | Human erythroleukaemia cell line K562 | NA | 30 % cytolytic activity in range of 3 -7 μM peptide concentration | NA | NA | NA | NA | NA | NA | Antibacterial against bacillus megaterium, E.coli, P.aeuroginosaand S.aureus | 1999 | 10585872 |
| antitb_1355 | NKLF1 | VTQAASRVCDKMKILRGVCKKIMRTFLRR | Free | Free | Internal disulphide bond at residue between 9-13 | Cyclic | 29 | L | NA | Natural | Pig cytolytic lymphocytes | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv ATCC 25619 | IC90 = 30 μM | In vitro | Human erythroleukaemia cell line K562 | NA | 31 % cytolytic activity in range of 3 -7 μM peptide concentration | NA | NA | NA | NA | NA | NA | Antibacterial against bacillus megaterium, E.coli, P.aeuroginosaand S.aureus | 1999 | 10585872 |
| antitb_1356 | NKLF2 | VCDKMKILRGVCKKIMRTFLRR | Free | Free | None | Cyclic | 22 | L | NA | Natural | Pig cytolytic lymphocytes | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv ATCC 25620 | IC90 = 30 μM | In vitro | Human erythroleukaemia cell line K562 | NA | 32 % cytolytic activity in range of 3 -7 μM peptide concentration | NA | NA | NA | NA | NA | NA | Antibacterial against bacillus megaterium, E.coli, P.aeuroginosaand S.aureus | 1999 | 10585872 |
| antitb_1357 | Gran F2 | VCRTGRSRWRDVCRNFMRRYQSR | Free | Free | Internal disulphide bond at residue between 2-13 | Cyclic | 23 | L | NA | Natural | Human cytolytic lymphocytes | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv ATCC 25621 | IC90 = 30 μM | In vitro | Human erythroleukaemia cell line K562 | NA | 33 % cytolytic activity in range of 3 -7 μM peptide concentration | NA | NA | NA | NA | NA | NA | Antibacterial against bacillus megaterium, E.coli, P.aeuroginosaand S.aureus | 1999 | 10585872 |
| antitb_1358 | Gran F1 | VSNAATRVCRTGRSRWRDVCRNFMRRYQSR | Free | Free | None | Linear | 30 | L | NA | Natural | Human cytolytic lymphocytes | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv ATCC 25622 | IC90 = 30 μM | In vitro | Human erythroleukaemia cell line K562 | NA | 34 % cytolytic activity in range of 3 -7 μM peptide concentration | NA | NA | NA | NA | NA | NA | Antibacterial against bacillus megaterium, E.coli, P.aeuroginosaand S.aureus | 1999 | 10585872 |
| antitb_1359 | Granulysin | TQRSVSNAATRVCRTGRSRWRDVCRNFMRRYQSRVTQG | Free | Free | None | Linear | 38 | L | NA | Natural | Human cytolytic lymphocytes | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv ATCC 25623 | IC90 = 30 μM | In vitro | Human erythroleukaemia cell line K562 | NA | 35 % cytolytic activity in range of 3 -7 μM peptide concentration | NA | NA | NA | NA | NA | NA | Antibacterial against bacillus megaterium, E.coli, P.aeuroginosaand S.aureus | 1999 | 10585872 |
| antitb_1360 | Pleurocidin | GWGSFFKKAAHVGKHVGKAALTHYL | Free | Free | None | Linear | 25 | L | NA | Natural | Pleuronectes americanus | Mycobacterium smegmatis | Mycobacterium smegmatis | MIC = 80 μg/ml | In vitro | None | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial against P.aeruginosa, K.pneumoniae,S.aureus and C.albicans | 2000 | 10898673 |
| antitb_1361 | Pleurocidin | GWGSFFKKAAHVGKHVGKAALTHYL | Free | Free | None | Linear | 25 | L | NA | Natural | Pleuronectes americanus | Mycobacterium smegmatis | Mycobacterium smegmatis | MIC = 20 μg/ml | In vitro | None | NA | NA | NA | NA | NA | NA | NA | 185 μM OF D-CYCLOSERINE DRUG + 5.2 μM OF Peptide reduces ~ 4 time MIC of drug | Antibacterial against P.aeruginosa, K.pneumoniae,S.aureus and C.albicans | 2000 | 10898673 |
| antitb_1362 | Thymus peptide | not available | NA | NA | None | NA | 0 | NA | NA | Natural | calf thymus | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 300 μg/ml | In vitro | None | NA | NA | NA | NA | NA | NA | NA | NA | NA | 1953 | 13118063 |
| antitb_1363 | Thymus peptide | not available | NA | NA | None | NA | 0 | NA | NA | Natural | calf thymus | Mycobacterium vallée | Mycobacterium vallée bovine | MIC = 300 μg/ml | In vitro | None | NA | NA | NA | NA | NA | NA | NA | NA | NA | 1953 | 13118063 |
| antitb_1364 | Thymus peptide | not available | NA | NA | None | NA | 0 | NA | NA | Natural | calf thymus | Mycobacterium R1Rv attenuated | Mycobacterium R1Rv attenuated human | MIC = 300 μg/ml | In vitro | None | NA | NA | NA | NA | NA | NA | NA | NA | NA | 1953 | 13118063 |
| antitb_1365 | Thymus peptide | not available | NA | NA | None | NA | 0 | NA | NA | Natural | calf thymus | BCG-phipps attenuated | BCG-phipps attenuated bovine | MIC = 300 μg/ml | In vitro | None | NA | NA | NA | NA | NA | NA | NA | NA | NA | 1953 | 13118063 |
| antitb_1366 | Thymus peptide | not available | NA | NA | None | NA | 0 | NA | NA | Natural | calf thymus | Mycobacterium H37Ra | Mycobacterium H37Ra avirlant Ra | MIC = 300 μg/ml | In vitro | None | NA | NA | NA | NA | NA | NA | NA | NA | NA | 1953 | 13118063 |
| antitb_1367 | Thymus peptide | not available | NA | NA | None | NA | 0 | NA | NA | Natural | calf thymus | Mycobacterium sigerson | Mycobacterium sigerson avium | MIC = 300 μg/ml | In vitro | None | NA | NA | NA | NA | NA | NA | NA | NA | NA | 1953 | 13118063 |
| antitb_1368 | Thymus peptide | not available | NA | NA | None | NA | 0 | NA | NA | Natural | calf thymus | Mycobacterium smegmatis | Mycobacterium smegmatis Saprophyte | MIC = 300 μg/ml | In vitro | None | NA | NA | NA | NA | NA | NA | NA | NA | NA | 1953 | 13118063 |
| antitb_1369 | Thymus peptide | not available | NA | NA | None | NA | 0 | NA | NA | Natural | Calf thymus | Mycobacterium tuberculii | Mycobacterium tuberculii BCG-Phipps | MIC = 100 μg/mL | In vitro | None | NA | NA | NA | NA | NA | NA | NA | NA | NA | 1953 | 13118063 |
| antitb_1388 | Hepcidin | DTHFPICIFCCGCCHRSKCGMCCKT | Free | Free | Disulphide linkage between cys7-23, cys10-13, cys11-19,cys14-22 | Cyclic | 25 | L | Cationic | Natural | Human alveolar type 2 epithilium | Mycobacterium tuberculosis | Mycobacterium H37Rv | NA | in vivo | A549 cell line | NA | No cytotoxicity | BALB/C | NA | Increased production of TNF-α, IL-1α | NA | Mycobacterium tuberculosis + IFN-Υ | antimicrobial | 2011 | 21482189 | |
| antitb_1389 | LL-37 | [LL-37, 37 aa] | Free | Free | None | Linear | 38 | L | Cationic | Natural | Murine macrophages | Mycobacteria smegmatis | M. smegmatis mc2 155 | MIC = 1μg /ml | in vitro | J774.A1 macrophage cell lines | 14% bacteria is cleared | NA | NA | NA | NA | NA | NA | NA | NA | 2011 | 21790937 |
| antitb_1390 | LL-37 | [LL-37, 37 aa] | Free | Free | None | Linear | 38 | L | Cationic | Natural | Murine macrophages | Mycobacteria smegmatis | M. smegmatis mc2 155 | MIC = 1μg /ml (after 6 hours) | in vitro | J774.A1 macrophage cell lines | 34% bacteria is cleared | NA | NA | NA | NA | NA | NA | NA | NA | 2011 | 21790937 |
| antitb_1391 | LL-37 | [LL-37, 37 aa] | Free | Free | None | Linear | 38 | L | Cationic | Natural | Murine macrophages | Mycobacteria smegmatis | M. smegmatis mc2 155 | MIC = 25μg/ml | in vitro | J774.A1 macrophage cell lines | 41% bacteria is cleared | NA | NA | NA | NA | NA | NA | NA | NA | 2011 | 21790937 |
| antitb_1392 | LL-37 | [LL-37, 37 aa] | Free | Free | None | Linear | 38 | L | Cationic | Natural | Murine macrophages | Mycobacteria smegmatis | M. smegmatis mc2 155 | MIC = 25μg /ml (after 6 hours incubation) | in vitro | J774.A1 macrophage cell lines | 67% bacteria is cleared | NA | NA | NA | NA | NA | NA | NA | NA | 2011 | 21790937 |
| antitb_1393 | GEK-31 | RKSKEKIGKEFKRIVQR IKDFLRNLVPRTES | Free | Free | None | Linear | 33 | L | Cationic | Natural | Murine macrophages | Mycobacteria smegmatis | M. smegmatis mc2 155 | NA | in vitro | J774.A1 macrophage cell lines | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2011 | 21790937 |
| antitb_1394 | LL-18 | KEFKRIVQRIKDFLRNLV | Free | Free | None | Linear | 19 | L | Cationic | Natural | Murine macrophages | Mycobacteria smegmatis | M. smegmatis mc2 155 | NA | in vitro | J774.A1 macrophage cell lines | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2011 | 21790937 |
| antitb_1395 | LLKKK-18 | KEFKRIVKRIKKFLRKLV | Free | Free | None | Linear | 19 | L | Cationic | Natural | Murine macrophages | Mycobacteria smegmatis | M. smegmatis mc2 155 | MIC = 1μg /ml | in vitro | J774.A1 macrophage cell lines | 67% bacteria is cleared | NA | NA | NA | NA | NA | NA | NA | NA | 2011 | 21790937 |
| antitb_1396 | LLKKK-18 | KEFKRIVKRIKKFLRKLV | Free | Free | None | Linear | 19 | L | Cationic | Natural | Murine macrophages | Mycobacteria smegmatis | M. smegmatis mc2 155 | MIC = 1μg /ml (after 6 hours) | in vitro | J774.A1 macrophage cell lines | 89% bacteria is cleared | NA | NA | NA | NA | NA | NA | NA | NA | 2011 | 21790937 |
| antitb_1397 | LLKKK-18 | KEFKRIVKRIKKFLRKLV | Free | Free | None | Linear | 19 | L | Cationic | Natural | Murine macrophages | Mycobacteria smegmatis | M. smegmatis mc2 155 | MIC = 25μg/ml | in vitro | J774.A1 macrophage cell lines | 81% bacteria is cleared | NA | NA | NA | NA | NA | NA | NA | NA | 2011 | 21790937 |
| antitb_1398 | LLKKK-18 | KEFKRIVKRIKKFLRKLV | Free | Free | None | Linear | 19 | L | Cationic | Natural | Murine macrophages | Mycobacteria smegmatis | M. smegmatis mc2 155 | MIC = 25μg /ml (after 6 hours incubation) | in vitro | J774.A1 macrophage cell lines | 98% bacteria is cleared | NA | NA | NA | NA | NA | NA | NA | NA | 2011 | 21790937 |
| antitb_1399 | LL-37 | [LL-37, 37 aa] | Free | Free | None | Linear | 38 | L | Cationic | Natural | Murine macrophages | Mycobacteria bovis | Mycobacteria bovis BCG | MIC = 25μg/ml | in vitro | THP-1 cells | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2011 | 21790937 |
| antitb_1400 | LL-37 | [LL-37, 37 aa] | Free | Free | None | Linear | 38 | L | Cationic | Natural | Murine macrophages | Mycobacteria bovis | Mycobacteria bovis BCG | MIC = 25μg /ml (after 624hours incubation) | in vitro | THP-1 cells | > 60% bacteria is cleared | NA | NA | NA | NA | NA | NA | NA | NA | 2011 | 21790937 |
| antitb_1401 | LLKKK-18 | KEFKRIVKRIKKFLRKLV | Free | Free | None | Linear | 19 | L | Cationic | Natural | Murine macrophages | Mycobacteria smegmatis | M. smegmatis mc2 155 | MIC = 1μg /ml | in vitro | J774.A1 macrophage cell lines | 51% bacteria is cleared | NA | NA | NA | NA | NA | NA | NA | NA | 2011 | 21790937 |
| antitb_1402 | LLKKK-18 | KEFKRIVKRIKKFLRKLV | Free | Free | None | Linear | 19 | L | Cationic | Natural | Murine macrophages | Mycobacteria smegmatis | M. smegmatis mc2 155 | MIC = 25μg/ml | in vitro | J774.A1 macrophage cell lines | 80% bacteria is cleared | NA | NA | NA | NA | NA | NA | NA | NA | 2011 | 21790937 |