| 1129 | OSK-1 (alpha-KTx3.7) (Venom peptide) | GVIINVKCKISRQCLEPCKKAGMRFGKCMNGKCHCTPK | 38 | L | None | None | None | Linear | Natural | Orthochirus scrobiculosus (scorpion) | K+ channel | Potassium channel blocker | Both | NA | NA | C57/BL6 mice | NA | 10 mg/kg | NA | 24333193 | 2014 |
| 1132 | Vm24 | AAAISCVGSPECPPKCRAQGCKNGKCMNRKCKCYYC | 36 | L | None | None | None | Linear | Natural | Vaejovis mexicanus smithi (scorpion) | Kv1.3 channels | Inhibits Kv1.3 channels | Both | COS-7, human embryonic kidney 293, tsA201, L929 and MEL cells | NA | Female Lewis rat (9-10 weeks of age) | Proliferation assay | NA | NA | 22622363 | 2012 |
| 1182 | SMRV-H peptide | EVVLQNRRGLDLLTAEQGGICLALQERCCFYANKS | 35 | D | None | None | None | Linear | Protein Derived | Squirrel monkey retrovirus (SMRV) | NA | Not Available | In vitro | U937, P2, JLS-V5 | NA | NA | NA | NA | NA | 3201749 | 1988 |
| 1183 | SRV-1 peptide | EVVLQNRRGLDLLTAEQGGICLALQEKCCFYANKS | 35 | L | None | None | None | Linear | Protein Derived | Simian retrovirus type-1 | NA | Not Available | In vitro | Human Lymphoblastoid Cell Line | NA | NA | NA | NA | NA | 3201749 | 1988 |
| 1184 | SRV-2 peptide | EVVLQNRRGLDLLTAEQGGICLALQEKCCFYANKS | 35 | L | None | None | None | Linear | Protein Derived | Simian retrovirus type-2 | NA | Not Available | In vitro | Human Lymphoblastoid Cell Line | NA | NA | NA | NA | NA | 3201749 | 1988 |
| 1185 | MPMV | EVVLQNRRGLDLLTAEQGGICLALQEKCCFYANKS | 35 | L | None | None | None | Linear | Protein Derived | Mason-Pfizer monkey virus | NA | Not Available | In vitro | Human Lymphoblastoid Cell Line | NA | NA | NA | NA | NA | 3201749 | 1988 |
| 1186 | REV-A | EVVLQNRRGLDLLTAEQGGICLALQEKCCFYANKS | 35 | L | None | None | None | Linear | Protein Derived | Reticuloendotheliosis-associated virus (REV-A) | NA | Not Available | In vitro | Human Lymphoblastoid Cell Line | NA | NA | NA | NA | NA | 3201749 | 1988 |
| 1187 | FeLV | EVVLQNRRGLDILFLQEGGLCAALKEECCFYADHT | 35 | L | None | None | None | Linear | Protein Derived | Feline leukemia virus (FeLV) | NA | Not Available | In vitro | Human Lymphoblastoid Cell Line | NA | NA | NA | NA | NA | 3201749 | 1988 |
| 1188 | Mo-MLV | EVVLQNRRGLDLLFLKEGGLCAALKEECCFYADHT | 35 | L | None | None | None | Linear | Protein Derived | Moloney murine leukemia virus | NA | Not Available | In vitro | Human Lymphoblastoid Cell Line | NA | NA | NA | NA | NA | 3201749 | 1988 |
| 1189 | RSV | HAVLQNRAAIDFLLLAHGHGCEDVAGMCCFNLSDH | 35 | L | None | None | None | Linear | Protein Derived | Respiratory syncytial virus | NA | Not Available | In vitro | Human Lymphoblastoid Cell Line | NA | NA | NA | NA | NA | 3201749 | 1988 |
| 1190 | HTLV-1 | QYAAQNRRGLDLLFWEQGGLCKALQEQCRFPNITN | 35 | L | None | None | None | Linear | Protein Derived | Human T-cell lymphotropic virus 1 | NA | Not Available | In vitro | Human Lymphoblastoid Cell Line | NA | NA | NA | NA | NA | 3201749 | 1988 |
| 1191 | HTLV-2 | QYAAQNRRGLDLLFWEQGGLCKALQEQCCFLNISN | 35 | L | None | None | None | Linear | Protein Derived | Human T-cell lymphotropic virus 2 | NA | Not Available | In vitro | Human Lymphoblastoid Cell Line | NA | NA | NA | NA | NA | 3201749 | 1988 |
| 1199 | LffX-I | VGINVKCKHSRQCLKPCKDAGMRFGKCTNGKCHCTPK | 37 | L | None | None | None | Linear | Natural | Scorpion venom | Kv1.3 potassium channels of T cells | high specificity binding Kv1.3 potassium channels of T cells | Both | C0S-7 cells | 1.08 pM | Arthritic Lewis rats, EAE model of Wistar rats | NA | NA | NA | CN 101423550 B | 2012 |
| 1214 | SEQ ID NO: 3 | MLMYILAKFLHWLGGYILAKFLHWLGGYILAKFLHWL | 37 | L | None | None | None | Linear | Protein Derived | human telomerase reverse transcriptase | Proteasome | Inhibits the overall activity of the proteasome | In vitro | HeLa, Saos | NA | NA | NA | NA | NA | DE 102006025146 A1 | 2007 |
| 1216 | SEQ ID NO: 5 | AHGVILAKFLHWLSTAPPAHGVILAKFLHWLSTAPPA | 37 | L | None | None | None | Linear | Protein Derived | human telomerase reverse transcriptase | Proteasome | Inhibits the overall activity of the proteasome | In vitro | HeLa, Saos | NA | NA | NA | NA | NA | DE 102006025146 A1 | 2007 |
| 1217 | SEQ ID NO: 6 | QMNLILAKFLHWLCMTWNQMNLILAKFLHWLCMTW | 35 | L | None | None | None | Linear | Protein Derived | human telomerase reverse transcriptase | Proteasome | Inhibits the overall activity of the proteasome | In vitro | HeLa, Saos | NA | NA | NA | NA | NA | DE 102006025146 A1 | 2007 |
| 1218 | SEQ ID NO: 7 | RLMYILAKFLHWLGPSRLMYILAKFLHWLGPS | 32 | L | None | None | None | Linear | Protein Derived | human telomerase reverse transcriptase | Proteasome | Inhibits the overall activity of the proteasome | In vitro | HeLa, Saos | NA | NA | NA | NA | NA | DE 102006025146 A1 | 2007 |
| 1219 | SEQ ID NO: 8 | VHNVILAKFLHWLSTAPPVHNVILAKFLHWLSTAPPV | 37 | L | None | None | None | Linear | Protein Derived | human telomerase reverse transcriptase | Proteasome | Inhibits the overall activity of the proteasome | In vitro | HeLa, Saos | NA | NA | NA | NA | NA | DE 102006025146 A1 | 2007 |
| 1268 | NA | CVCVCLLPRYPSAGVFTYLNTKIITFDSVLSCA | 33 | L | None | None | None | Linear | Protein Derived | Amino acid sequences derived from a human native nucleotide sequence capable of expressing GIF (glycosylation-inhibiting factors) | B-cells | Glycosylation inhibiting factor activity causing the suppression of immunoglobulin E (IgE) production | In vitro | Mesenteric lymph node (MLN) cells | NA | Lewis Rat | Rosette inhibition assay, tests of the IgE-SF activity | NA | NA | EP 0255394 A2 | 1987 |
| 1304 | None | CVCVCLLPRYPSAGVFTYLNTKIITFDSVLSKCA | 34 | L | None | None | None | Linear | Synthetic | Native nucloetide sequence capable of expressing GIF activity | Tissue harboring the parasite | Inhibit glycosylation inhibiting factors, which inhibits IgE production | Both | Spleen cells | NA | BALB/c | Hummoral Immune Response assay | NA | NA | US 4749685 | 1988 |
| 1305 | None | CVCVCIIPRYPSAGVFTYINTKIITFDSVISKCA | 35 | L | None | None | None | Linear | Synthetic | Native nucloetide sequence capable of expressing GIF activity | Tissue harboring the parasite | Inhibit glycosylation inhibiting factors, which inhibits IgE production | Both | Spleen cells | NA | BALB/c | Hummoral Immune Response assay | NA | NA | US 4749685 | 1988 |
| 1306 | None | CVCVCMMPRYPSAGVFTYMNTKIITFDSVMSKCA | 36 | L | None | None | None | Linear | Synthetic | Native nucloetide sequence capable of expressing GIF activity | Tissue harboring the parasite | Inhibit glycosylation inhibiting factors, which inhibits IgE production | Both | Spleen cells | NA | BALB/c | Hummoral Immune Response assay | NA | NA | US 4749685 | 1988 |
| 1307 | None | CVCVCLLPRYPSAGVFTYLNTKIITFDSVLSKCA | 37 | L | None | None | None | Linear | Synthetic | Native nucloetide sequence capable of expressing GIF activity | Tissue harboring the parasite | Inhibit glycosylation inhibiting factors, which inhibits IgE production | Both | Spleen cells | NA | BALB/c | Hummoral Immune Response assay | NA | NA | US 4749685 | 1988 |
| 1308 | None | CVCVCIIPRYPSAGVFTYINTKMMTFDSVISKCA | 38 | L | None | None | None | Linear | Synthetic | Native nucloetide sequence capable of expressing GIF activity | Tissue harboring the parasite | Inhibit glycosylation inhibiting factors, which inhibits IgE production | Both | Spleen cells | NA | BALB/c | Hummoral Immune Response assay | NA | NA | US 4749685 | 1988 |
| 1309 | None | CVCVCLLPRYPSAGVFTYLNTKLLTFDSVLSKCA | 39 | L | None | None | None | Linear | Synthetic | Native nucloetide sequence capable of expressing GIF activity | Tissue harboring the parasite | Inhibit glycosylation inhibiting factors, which inhibits IgE production | Both | Spleen cells | NA | BALB/c | Hummoral Immune Response assay | NA | NA | US 4749685 | 1988 |
| 1310 | None | CVCVCLLPRYPSAGVFTYLNTKIITFDSVLSKCA | 40 | L | None | None | None | Linear | Synthetic | Native nucloetide sequence capable of expressing GIF activity | Tissue harboring the parasite | Inhibit glycosylation inhibiting factors, which inhibits IgE production | Both | Spleen cells | NA | BALB/c | Hummoral Immune Response assay | NA | NA | US 4749685 | 1988 |
| 1375 | SEQ ID2 | SCIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC | 34 | L | None | None | N-acetylation at position 18 | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1376 | SEQ ID3 | CIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC | 33 | L | None | None | None | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1377 | SEQ ID4 | RSCIDTIPKSECTAFQCKHSMKYRLSFCRKTCGTC | 35 | L | None | None | N-acetylation at position 19 | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1378 | SEQ ID5 | RSCIDTIPKSRCTAFECKHSMKYRLSFCRKTCGTC | 35 | L | None | None | None | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1379 | SEQ ID6 | RSCIDTIPKSRCTAFQCKKSMKYRLSFCRKTCGTC | 35 | L | None | None | None | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1380 | SEQ ID7 | RSCIDTIPKSRCTAFQCKHSMEYRLSFCRKTCGTC | 35 | L | None | None | None | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1381 | SEQ ID8 | RSCIDTIPKSRCTAFQCKHSMKXYRLSFCRKTCGTC | 36 | L | None | None | X = cyclohexylalanine | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1382 | SEQ ID9 | RSCIDTIPKSRCTAFQCKHSMAYRLSXCRKTCGTC | 35 | L | None | None | X = cyclohexylalanine | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1383 | SEQ ID10 | RSCATIPKSRCTAAQCKHSMKYRLSFCRKRCGTC | 34 | L | None | None | None | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1384 | SEQ ID11 | RSCIDSTIPKSRCTAAQKHSMKYRASFCRKTCGTC | 35 | L | None | None | None | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1385 | SEQ ID12 | RSCADTIPKSRCTAAQCKHSMKYRASFCRKTCGTC | 35 | L | None | None | None | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1386 | SEQ ID13 | SSCIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC | 35 | L | None | None | None | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1387 | SEQ ID14 | RSCIDTIPQSRCTAFQCKHSMKYRLSFCRKTCGTC | 35 | L | None | None | None | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1388 | SEQ ID15 | RSCIDTIPKSQCTAFQCKHSMKYRLSFCRKTCGTC | 35 | L | None | None | None | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1389 | SEQ ID16 | RSCIDTIPKSRCTAAQCKHSMKYRLSFCRKTCGTC | 35 | L | None | None | None | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1390 | SEQ ID17 | RSCIDTIPKSQCTAWQCKHSMKYRLSFCRKTCGTC | 35 | L | None | None | None | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1391 | SEQ ID18 | RSCIDTIPKSQCTAFQCAHSMKYRLSFCRKTCGTC | 35 | L | None | None | None | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1392 | SEQ ID19 | RSCIDTIPKSQCTAFQCKHSXKYRLSFCRKTCGTC | 35 | L | None | None | X = norleucine (nL) | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1393 | SEQ ID20 | RSCIDTIPKSRCTAFQCKHSMAYRLSFCRKTCGTC | 35 | L | None | None | None | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1394 | SEQ ID21 | RSCIDTIPKSRCTAFQCKHSMXYRLSFCRKTCGTC | 35 | L | None | None | X = norleucine (nL) | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1395 | SEQ ID22 | RSCIDTIPKSRCTAFQCKHSMXYRLSFCRKTCGTC | 35 | L | None | None | X = ornithine | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1396 | SEQ ID23 | RSCIDTIPKSRCTAFQCKHSMXYRLSFCRKTCGTC | 35 | L | None | None | X = homocitrulline | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1397 | SEQ ID24 | RSCIDTIPKSRCTAFQCRHSMRYRLSFCRKTCGTC | 35 | L | None | None | None | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1398 | SEQ ID25 | RSCIDTIPKSRCTAFQCKHSMKFRLSFCRKTCGTC | 35 | L | None | None | None | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
