Browse result page of ImmunoSPdb

The total number entries retrieved from this search are 136

ID	Name	Sequence	Length	Chirality	N-Terminal Modification	C-Terminal Modification	Chemical Modification	Linear/Cyclic	Nature	Source	Target	Mechanism of Action	In vivo/ In vitro	Cell Line	IC-50	In vivo Model	Assay Type	Lethal Dose	Combination Therapy	Pubmed ID	Year of Publication
1399	SEQ ID26	RSCIDTIPKSRCTAFQCKHSMKXRLSFCRKTCGTC	35	L	None	None	X = nitrophenylalanine	Linear	Natural	Shk toxin of S.helianthus	T Lymphocytes Kv1.3 channels	By blocking the potassium channel, Kv1.3 of T lymphocytes	Both	Peripheral blood human lymhocytes	1 nM	CD18-nullPL/J mice	Enzyme-linked immunosorbent assay (ELISA), HPLC	NA	Charybdotoxin (ChTX)	US 6077680	2000
1400	SEQ ID27	RSCIDTIPKSRCTAFQCKHSMKXRLSFCRKTCGTC	35	L	None	None	X = aminophenylalanine	Linear	Natural	Shk toxin of S.helianthus	T Lymphocytes Kv1.3 channels	By blocking the potassium channel, Kv1.3 of T lymphocytes	Both	Peripheral blood human lymhocytes	1 nM	CD18-nullPL/J mice	Enzyme-linked immunosorbent assay (ELISA), HPLC	NA	Charybdotoxin (ChTX)	US 6077680	2000
1401	SEQ ID28	RSCIDTIPKSRCTAFQCKHSMKYALSFCRKTCGTC	35	L	None	None	None	Linear	Natural	Shk toxin of S.helianthus	T Lymphocytes Kv1.3 channels	By blocking the potassium channel, Kv1.3 of T lymphocytes	Both	Peripheral blood human lymhocytes	1 nM	CD18-nullPL/J mice	Enzyme-linked immunosorbent assay (ELISA), HPLC	NA	Charybdotoxin (ChTX)	US 6077680	2000
1402	SEQ ID29	ASCIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC	35	L	None	None	None	Linear	Natural	Shk toxin of S.helianthus	T Lymphocytes Kv1.3 channels	By blocking the potassium channel, Kv1.3 of T lymphocytes	Both	Peripheral blood human lymhocytes	1 nM	CD18-nullPL/J mice	Enzyme-linked immunosorbent assay (ELISA), HPLC	NA	Charybdotoxin (ChTX)	US 6077680	2000
1403	SEQ ID30	RACIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC	35	L	None	None	None	Linear	Natural	Shk toxin of S.helianthus	T Lymphocytes Kv1.3 channels	By blocking the potassium channel, Kv1.3 of T lymphocytes	Both	Peripheral blood human lymhocytes	1 nM	CD18-nullPL/J mice	Enzyme-linked immunosorbent assay (ELISA), HPLC	NA	Charybdotoxin (ChTX)	US 6077680	2000
1404	SEQ ID31	RSCADTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC	35	L	None	None	None	Linear	Natural	Shk toxin of S.helianthus	T Lymphocytes Kv1.3 channels	By blocking the potassium channel, Kv1.3 of T lymphocytes	Both	Peripheral blood human lymhocytes	1 nM	CD18-nullPL/J mice	Enzyme-linked immunosorbent assay (ELISA), HPLC	NA	Charybdotoxin (ChTX)	US 6077680	2000
1405	SEQ ID32	RSCIATIPKSRCTAFQCKHSMKYRLSFCRKTCGTC	35	L	None	None	None	Linear	Natural	Shk toxin of S.helianthus	T Lymphocytes Kv1.3 channels	By blocking the potassium channel, Kv1.3 of T lymphocytes	Both	Peripheral blood human lymhocytes	1 nM	CD18-nullPL/J mice	Enzyme-linked immunosorbent assay (ELISA), HPLC	NA	Charybdotoxin (ChTX)	US 6077680	2000
1406	SEQ ID33	RSCIDAIPKSRCTAFQCKHSMKYRLSFCRKTCGTC	35	L	None	None	None	Linear	Natural	Shk toxin of S.helianthus	T Lymphocytes Kv1.3 channels	By blocking the potassium channel, Kv1.3 of T lymphocytes	Both	Peripheral blood human lymhocytes	1 nM	CD18-nullPL/J mice	Enzyme-linked immunosorbent assay (ELISA), HPLC	NA	Charybdotoxin (ChTX)	US 6077680	2000
1407	SEQ ID34	RSCIDTAPKSRCTAFQCKHSMKYRLSFCRKTCGTC	35	L	None	None	None	Linear	Natural	Shk toxin of S.helianthus	T Lymphocytes Kv1.3 channels	By blocking the potassium channel, Kv1.3 of T lymphocytes	Both	Peripheral blood human lymhocytes	1 nM	CD18-nullPL/J mice	Enzyme-linked immunosorbent assay (ELISA), HPLC	NA	Charybdotoxin (ChTX)	US 6077680	2000
1408	SEQ ID35	RSCIDTIAKSRCTAFQCKHSMKYRLSFCRKTCGTC	35	L	None	None	None	Linear	Natural	Shk toxin of S.helianthus	T Lymphocytes Kv1.3 channels	By blocking the potassium channel, Kv1.3 of T lymphocytes	Both	Peripheral blood human lymhocytes	1 nM	CD18-nullPL/J mice	Enzyme-linked immunosorbent assay (ELISA), HPLC	NA	Charybdotoxin (ChTX)	US 6077680	2000
1409	SEQ ID36	RSCIDTIPASRCTAFQCKHSMKYRLSFCRKTCGTC	35	L	None	None	None	Linear	Natural	Shk toxin of S.helianthus	T Lymphocytes Kv1.3 channels	By blocking the potassium channel, Kv1.3 of T lymphocytes	Both	Peripheral blood human lymhocytes	1 nM	CD18-nullPL/J mice	Enzyme-linked immunosorbent assay (ELISA), HPLC	NA	Charybdotoxin (ChTX)	US 6077680	2000
1410	SEQ ID37	RSCIDTIPKARCTAFQCKHSMKYRLSFCRKTCGTC	35	L	None	None	None	Linear	Natural	Shk toxin of S.helianthus	T Lymphocytes Kv1.3 channels	By blocking the potassium channel, Kv1.3 of T lymphocytes	Both	Peripheral blood human lymhocytes	1 nM	CD18-nullPL/J mice	Enzyme-linked immunosorbent assay (ELISA), HPLC	NA	Charybdotoxin (ChTX)	US 6077680	2000
1411	SEQ ID38	RSCIDTIPKSACTAFQCKHSMKYRLSFCRKTCGTC	35	L	None	None	None	Linear	Natural	Shk toxin of S.helianthus	T Lymphocytes Kv1.3 channels	By blocking the potassium channel, Kv1.3 of T lymphocytes	Both	Peripheral blood human lymhocytes	1 nM	CD18-nullPL/J mice	Enzyme-linked immunosorbent assay (ELISA), HPLC	NA	Charybdotoxin (ChTX)	US 6077680	2000
1412	SEQ ID39	RSCIDTIPKSRCAAFQCKHSMKYRLSFCRKTCGTC	35	L	None	None	None	Linear	Natural	Shk toxin of S.helianthus	T Lymphocytes Kv1.3 channels	By blocking the potassium channel, Kv1.3 of T lymphocytes	Both	Peripheral blood human lymhocytes	1 nM	CD18-nullPL/J mice	Enzyme-linked immunosorbent assay (ELISA), HPLC	NA	Charybdotoxin (ChTX)	US 6077680	2000
1413	SEQ ID40	RSCIDTIPKSRCTAAQCKHSMKYRLSFCRKTCGTC	35	L	None	None	None	Linear	Natural	Shk toxin of S.helianthus	T Lymphocytes Kv1.3 channels	By blocking the potassium channel, Kv1.3 of T lymphocytes	Both	Peripheral blood human lymhocytes	1 nM	CD18-nullPL/J mice	Enzyme-linked immunosorbent assay (ELISA), HPLC	NA	Charybdotoxin (ChTX)	US 6077680	2000
1414	SEQ ID41	RSCIDTIPKSRCTAFACKHSMKYRLSFCRKTCGTC	35	L	None	None	None	Linear	Natural	Shk toxin of S.helianthus	T Lymphocytes Kv1.3 channels	By blocking the potassium channel, Kv1.3 of T lymphocytes	Both	Peripheral blood human lymhocytes	1 nM	CD18-nullPL/J mice	Enzyme-linked immunosorbent assay (ELISA), HPLC	NA	Charybdotoxin (ChTX)	US 6077680	2000
1415	SEQ ID42	RSCIDTIPKSRCTAFQCAHSMKYRLSFCRKTCGTC	35	L	None	None	None	Linear	Natural	Shk toxin of S.helianthus	T Lymphocytes Kv1.3 channels	By blocking the potassium channel, Kv1.3 of T lymphocytes	Both	Peripheral blood human lymhocytes	1 nM	CD18-nullPL/J mice	Enzyme-linked immunosorbent assay (ELISA), HPLC	NA	Charybdotoxin (ChTX)	US 6077680	2000
1416	SEQ ID43	RSCIDTIPKSRCTAFQCKASMKYRLSFCRKTCGTC	35	L	None	None	None	Linear	Natural	Shk toxin of S.helianthus	T Lymphocytes Kv1.3 channels	By blocking the potassium channel, Kv1.3 of T lymphocytes	Both	Peripheral blood human lymhocytes	1 nM	CD18-nullPL/J mice	Enzyme-linked immunosorbent assay (ELISA), HPLC	NA	Charybdotoxin (ChTX)	US 6077680	2000
1417	SEQ ID44	RSCIDTIPKSRCTAFQCKHAMKYRLSFCRKTCGTC	35	L	None	None	None	Linear	Natural	Shk toxin of S.helianthus	T Lymphocytes Kv1.3 channels	By blocking the potassium channel, Kv1.3 of T lymphocytes	Both	Peripheral blood human lymhocytes	1 nM	CD18-nullPL/J mice	Enzyme-linked immunosorbent assay (ELISA), HPLC	NA	Charybdotoxin (ChTX)	US 6077680	2000
1418	SEQ ID45	RSCIDTIPKSRCTAFQCKHSAKYRLSFCRKTCGTC	35	L	None	None	None	Linear	Natural	Shk toxin of S.helianthus	T Lymphocytes Kv1.3 channels	By blocking the potassium channel, Kv1.3 of T lymphocytes	Both	Peripheral blood human lymhocytes	1 nM	CD18-nullPL/J mice	Enzyme-linked immunosorbent assay (ELISA), HPLC	NA	Charybdotoxin (ChTX)	US 6077680	2000
1419	SEQ ID46	RSCIDTIPKSRCTAFQCKHSMAYRLSFCRKTCGTC	35	L	None	None	None	Linear	Natural	Shk toxin of S.helianthus	T Lymphocytes Kv1.3 channels	By blocking the potassium channel, Kv1.3 of T lymphocytes	Both	Peripheral blood human lymhocytes	1 nM	CD18-nullPL/J mice	Enzyme-linked immunosorbent assay (ELISA), HPLC	NA	Charybdotoxin (ChTX)	US 6077680	2000
1420	SEQ ID47	RSCIDTIPKSRCTAFQCKHSMKARLSFCRKTCGTC	35	L	None	None	None	Linear	Natural	Shk toxin of S.helianthus	T Lymphocytes Kv1.3 channels	By blocking the potassium channel, Kv1.3 of T lymphocytes	Both	Peripheral blood human lymhocytes	1 nM	CD18-nullPL/J mice	Enzyme-linked immunosorbent assay (ELISA), HPLC	NA	Charybdotoxin (ChTX)	US 6077680	2000
1421	SEQ ID48	RSCIDTIPKSRCTAFQCKHSMKYALSFCRKTCGTC	35	L	None	None	None	Linear	Natural	Shk toxin of S.helianthus	T Lymphocytes Kv1.3 channels	By blocking the potassium channel, Kv1.3 of T lymphocytes	Both	Peripheral blood human lymhocytes	1 nM	CD18-nullPL/J mice	Enzyme-linked immunosorbent assay (ELISA), HPLC	NA	Charybdotoxin (ChTX)	US 6077680	2000
1422	SEQ ID49	RSCIDTIPKSRCTAFQCKHSMKYRASFCRKTCGTC	35	L	None	None	None	Linear	Natural	Shk toxin of S.helianthus	T Lymphocytes Kv1.3 channels	By blocking the potassium channel, Kv1.3 of T lymphocytes	Both	Peripheral blood human lymhocytes	1 nM	CD18-nullPL/J mice	Enzyme-linked immunosorbent assay (ELISA), HPLC	NA	Charybdotoxin (ChTX)	US 6077680	2000
1423	SEQ ID50	RSCIDTIPKSRCTAFQCKHSMKYRLAFCRKTCGTC	35	L	None	None	None	Linear	Natural	Shk toxin of S.helianthus	T Lymphocytes Kv1.3 channels	By blocking the potassium channel, Kv1.3 of T lymphocytes	Both	Peripheral blood human lymhocytes	1 nM	CD18-nullPL/J mice	Enzyme-linked immunosorbent assay (ELISA), HPLC	NA	Charybdotoxin (ChTX)	US 6077680	2000
1424	SEQ ID51	RSCIDTIPKSRCTAFQCKHSMKYRLSACRKTCGTC	35	L	None	None	None	Linear	Natural	Shk toxin of S.helianthus	T Lymphocytes Kv1.3 channels	By blocking the potassium channel, Kv1.3 of T lymphocytes	Both	Peripheral blood human lymhocytes	1 nM	CD18-nullPL/J mice	Enzyme-linked immunosorbent assay (ELISA), HPLC	NA	Charybdotoxin (ChTX)	US 6077680	2000
1425	SEQ ID52	RSCIDTIPKSRCTAFQCKHSMKYRLSFCAKTCGTC	35	L	None	None	None	Linear	Natural	Shk toxin of S.helianthus	T Lymphocytes Kv1.3 channels	By blocking the potassium channel, Kv1.3 of T lymphocytes	Both	Peripheral blood human lymhocytes	1 nM	CD18-nullPL/J mice	Enzyme-linked immunosorbent assay (ELISA), HPLC	NA	Charybdotoxin (ChTX)	US 6077680	2000
1426	SEQ ID53	RSCIDTIPKSRCTAPQCKHSMKYRLSFCRATCGTC	35	L	None	None	None	Linear	Natural	Shk toxin of S.helianthus	T Lymphocytes Kv1.3 channels	By blocking the potassium channel, Kv1.3 of T lymphocytes	Both	Peripheral blood human lymhocytes	1 nM	CD18-nullPL/J mice	Enzyme-linked immunosorbent assay (ELISA), HPLC	NA	Charybdotoxin (ChTX)	US 6077680	2000
1427	SEQ ID54	RSCIDTIPKSRCTAPQCKHSMKYRLSFCRKACGTC	35	L	None	None	None	Linear	Natural	Shk toxin of S.helianthus	T Lymphocytes Kv1.3 channels	By blocking the potassium channel, Kv1.3 of T lymphocytes	Both	Peripheral blood human lymhocytes	1 nM	CD18-nullPL/J mice	Enzyme-linked immunosorbent assay (ELISA), HPLC	NA	Charybdotoxin (ChTX)	US 6077680	2000
1428	SEQ ID55	RSCIDTIPKSRCTAPQCKHSMKYRLSFCRKTCGAC	35	L	None	None	None	Linear	Natural	Shk toxin of S.helianthus	T Lymphocytes Kv1.3 channels	By blocking the potassium channel, Kv1.3 of T lymphocytes	Both	Peripheral blood human lymhocytes	1 nM	CD18-nullPL/J mice	Enzyme-linked immunosorbent assay (ELISA), HPLC	NA	Charybdotoxin (ChTX)	US 6077680	2000
1429	SEQ ID56	RSCIDTIPKSRCTAFQCKHSMXYRLSFCRKTCGTC	35	L	None	None	X = diaminopropanoic acid	Linear	Natural	Shk toxin of S.helianthus	T Lymphocytes Kv1.3 channels	By blocking the potassium channel, Kv1.3 of T lymphocytes	Both	Peripheral blood human lymhocytes	1 nM	CD18-nullPL/J mice	Enzyme-linked immunosorbent assay (ELISA), HPLC	NA	Charybdotoxin (ChTX)	US 6077680	2000
1430	SEQ ID57	RSCIDTIPKSRCTAFQCKHSMKXRLSFCRKTCGTC	35	L	None	None	X = benzoylphenylalanine	Linear	Natural	Shk toxin of S.helianthus	T Lymphocytes Kv1.3 channels	By blocking the potassium channel, Kv1.3 of T lymphocytes	Both	Peripheral blood human lymhocytes	1 nM	CD18-nullPL/J mice	Enzyme-linked immunosorbent assay (ELISA), HPLC	NA	Charybdotoxin (ChTX)	US 6077680	2000
1431	SEQ ID58	XSCIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC	35	L	None	None	X = N-acetyl-arginine	Linear	Natural	Shk toxin of S.helianthus	T Lymphocytes Kv1.3 channels	By blocking the potassium channel, Kv1.3 of T lymphocytes	Both	Peripheral blood human lymhocytes	1 nM	CD18-nullPL/J mice	Enzyme-linked immunosorbent assay (ELISA), HPLC	NA	Charybdotoxin (ChTX)	US 6077680	2000
1432	SEQ ID59	RSCIDTIPKSRCTAXQCKHSMKYRLSFCRKTCGTC	35	L	None	None	X = azidophenylalanine	Linear	Natural	Shk toxin of S.helianthus	T Lymphocytes Kv1.3 channels	By blocking the potassium channel, Kv1.3 of T lymphocytes	Both	Peripheral blood human lymhocytes	1 nM	CD18-nullPL/J mice	Enzyme-linked immunosorbent assay (ELISA), HPLC	NA	Charybdotoxin (ChTX)	US 6077680	2000
1433	SEQ ID60	RSCIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC	35	L	None	None	None	Cyclic (C3-C35, C12	Natural	Shk toxin of S.helianthus	T Lymphocytes Kv1.3 channels	By blocking the potassium channel, Kv1.3 of T lymphocytes	Both	Peripheral blood human lymhocytes	1 nM	CD18-nullPL/J mice	Enzyme-linked immunosorbent assay (ELISA), HPLC	NA	Charybdotoxin (ChTX)	US 6077680	2000
1434	SEQ ID61	RSCIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC	35	L	None	None	None	Cyclic (C3-C35)	Natural	Shk toxin of S.helianthus	T Lymphocytes Kv1.3 channels	By blocking the potassium channel, Kv1.3 of T lymphocytes	Both	Peripheral blood human lymhocytes	1 nM	CD18-nullPL/J mice	Enzyme-linked immunosorbent assay (ELISA), HPLC	NA	Charybdotoxin (ChTX)	US 6077680	2000