1063 | Kalata B1 | GLPVCGETCVGGTCNTPGCTCSWPVCTRN | 29 | L | None | None | Three cystine knot Disulfide connectivity (CI-CIV, CII-CV and CIII-CVI) | Cyclic | Natural | From Oldenlandia affinis Plant Extract | NA | Inhibits the growth of the Lymphocytes in a cytostatic fashion | In vitro | Human Peripheral Blood Mononuclear Cells | 3.9±0.5 micromolar for antiproliferative effect on PBMC | NA | Cell Proliferation assay, Cell division assay | 14 micromolar of the peptide are cytotoxic to the cells | NA | 22272797 | 2012 |
1064 | Antamanide | VPPAFFPPFF | 10 | L | None | None | None | Cyclic | Natural | Isolated from the poisonous mushroom Amanita phalloides | Peptidyl-prolyl cis-trans isomerase CyP-D | Inhibit mitochondrial permeability transition pore | Both | HeLa Cells | NA | C57BL/6 mice | Cell Viability assay, Ca2+ retention capacity assay | NA | NA | 21297983 | 2011 |
1065 | Cyclolinopeptide A (CLA) | VPPFFLIIL | 9 | L | None | None | None | Cyclic | Synthetic | NA | NA | Inhibition of the action of interleukin-1 and interleukin-2 | Both | SRBC (sheep red blood cells) | NA | CBA/Iiw mice 8-10 weeks | Humoral immune response test,PFC (plaque froming cell) test, DTH (delayed type hypersensitivity) test | NA | NA | 8441706 | 1992 |
1066 | Antamanide | VPPAFFPPFF | 10 | L | None | None | None | Cyclic | Natural | Isolated from the mushroom Amanita phalloides | NA | Not investigated | Both | SRBC (sheep red blood cells) | NA | CBA/Iiw mice 8-10 weeks | Humoral immune response test,PFC (plaque froming cell) test, DTH (delayed type hypersensitivity) test | NA | NA | 8441706 | 1992 |
1067 | Cycloamanide A (CyA A) | VFFAGP | 6 | L | None | None | None | Cyclic | Natural | Isolated from the mushroom Amanita phalloides | NA | Not investigated | Both | SRBC (sheep red blood cells) | NA | CBA/Iiw mice 8-10 weeks | Humoral immune response test,PFC (plaque froming cell) test, DTH (delayed type hypersensitivity) test | NA | NA | 8441706 | 1992 |
1068 | [D-Phe3]CyA A | VFfAGP | 6 | Mix | None | None | None | Cyclic | Synthetic | NA | NA | Not investigated | Both | SRBC (sheep red blood cells) | NA | CBA/Iiw mice 8-10 weeks | Humoral immune response test,PFC (plaque froming cell) test, DTH (delayed type hypersensitivity) test | NA | NA | 8441706 | 1992 |
1069 | Cycloamanide B (CyA B) | FFFPIPS | 7 | L | None | None | None | Cyclic | Natural | Isolated from the mushroom Amanita phalloides | NA | Not investigated | Both | SRBC (sheep red blood cells) | NA | CBA/Iiw mice 8-10 weeks | Humoral immune response test,PFC (plaque froming cell) test, DTH (delayed type hypersensitivity) test | NA | NA | 8441706 | 1992 |
1070 | [D-Ser]CyA B | FFFPIPs | 7 | Mix | None | None | None | Cyclic | Synthetic | NA | NA | Not investigated | Both | SRBC (sheep red blood cells) | NA | CBA/Iiw mice 8-10 weeks | Humoral immune response test,PFC (plaque froming cell) test, DTH (delayed type hypersensitivity) test | NA | NA | 8441706 | 1992 |
1071 | Cycloamanide C | LPMLGFLV | 8 | L | None | None | R and S sulfoxide on methionine | Cyclic | Natural | Isolated from the mushroom Amanita phalloides | NA | Not investigated | Both | SRBC (sheep red blood cells) | NA | CBA/Iiw mice 8-10 weeks | Humoral immune response test,PFC (plaque froming cell) test, DTH (delayed type hypersensitivity) test | NA | NA | 8441706 | 1992 |
1072 | Cycloamanide D | LPMLGFLP | 8 | L | None | None | R and S sulfoxide on methionine | Cyclic | Natural | Isolated from the mushroom Amanita phalloides | NA | Not investigated | Both | SRBC (sheep red blood cells) | NA | CBA/Iiw mice 8-10 weeks | Humoral immune response test,PFC (plaque froming cell) test, DTH (delayed type hypersensitivity) test | NA | NA | 8441706 | 1992 |
1073 | Retro-[D-Phe3]CyA A | fFVPGA | 6 | Mix | None | None | None | Cyclic | Synthetic | NA | NA | Not investigated | Both | SRBC (sheep red blood cells) | NA | CBA/Iiw mice 8-10 weeks | Humoral immune response test,PFC (plaque froming cell) test, DTH (delayed type hypersensitivity) test | NA | NA | 8441706 | 1992 |
1074 | Retro-[D-Phe3]CyA A | fFVPGA | 6 | Mix | None | None | None | Linear | Synthetic | NA | NA | Not investigated | Both | SRBC (sheep red blood cells) | NA | CBA/Iiw mice 8-10 weeks | Humoral immune response test,PFC (plaque froming cell) test, DTH (delayed type hypersensitivity) test | NA | NA | 8441706 | 1992 |
1078 | CSK-17 | LQNRRGLDLLFLKEGGL | 18 | L | None | None | None | Linear | Synthetic | NA | NA | Inhibition of human Lymphocyte | NA | NA | NA | NA | NA | NA | NA | 2421920 | 1986 |
1079 | MPMV | EVVLQNRRGLDLLTAEQGGICLALQEKCCFYANKS | 35 | L | None | None | None | Linear | Protein Derived | From the envelope protein of Mason-Pfizer monkey virus | NA | Inhibition of human Lymphocyte | NA | NA | NA | NA | NA | NA | NA | 2421920 | 1986 |
1080 | REV-A | EVVLQNRRGLDLLTAEQGGICLALQEKCCFYANKS | 35 | L | None | None | None | Linear | Protein Derived | From the transmembrane protein of reticuloendotheliosis associated virus | NA | Inhibition of human Lymphocyte | NA | NA | NA | NA | NA | NA | NA | 2421920 | 1986 |
1081 | FeLV | EVVLQNRRGLDILFLQEGGLCAALKEECCFYADHT | 35 | L | None | None | None | Linear | Protein Derived | From the transmembrane protein of feline leukemia virus | NA | Inhibition of human Lymphocyte | NA | NA | NA | NA | NA | NA | NA | 2421920 | 1986 |
1082 | Mo-MLV | EVVLQNRRGLDLLFLKEGGLCAALKEECCFYADHT | 35 | L | None | None | None | Linear | Protein Derived | From the transmembrane protein of Moloney murine leukemia virus | NA | Inhibition of human Lymphocyte | NA | NA | NA | NA | NA | NA | NA | 2421920 | 1986 |
1083 | RSV | HAVLQNRAAIDFLLLAHGHGCEDVAGMCCFNLSDH | 35 | L | None | None | None | Linear | Protein Derived | From the transmembrane protein of Rous Sarcoma Virus | NA | Inhibition of human Lymphocyte | NA | NA | NA | NA | NA | NA | NA | 2421920 | 1986 |
1084 | HTLV-1 | QYAAQNRRGLDLLFWEQGGLCKALQEQCRFPNITN | 35 | L | None | None | None | Linear | Protein Derived | From the transmembrane protein of human T cell leukemia viruses type 1 | NA | Inhibition of human Lymphocyte | NA | NA | NA | NA | NA | NA | NA | 2421920 | 1986 |
1085 | HTLV-2 | QYAAQNRRGLDLLFWEQGGLCKALQEQCCFLNISN | 35 | L | None | None | None | Linear | Protein Derived | From the transmembrane protein of human T cell leukemia viruses type 2 | NA | Inhibition of human Lymphocyte | NA | NA | NA | NA | NA | NA | NA | 2421920 | 1986 |
1086 | Ac1-9 | ASQKRPSQR | 9 | L | Acetylation | None | None | Linear | Protein Derived | From myelin basic protein | IL-10 and IL-2 | peptide-induced regulatory cells suppress the response of naive T cells and leads to the generation of IL-10-secreting regulatory cells | Both | purified T cells | NA | Tg4 transgenic mouse | CD4 T cell Proliferation assays, Cytokine protein levels assays | NA | NA | 12538682 | 2003 |
1087 | MHC-binding analog (Ac1-9[4Y]) | ASQYRPSQR | 9 | L | Acetylation | None | None | Linear | Synthetic | Analog of Ac1-9 | IL-10 and IL-3 | peptide-induced regulatory cells suppress the response of naive T cells and leads to the generation of IL-10-secreting regulatory cells | Both | purified T cells | NA | Tg4 transgenic mouse | CD4 T cell Proliferation assays, Cytokine protein levels assays | NA | NA | 12538682 | 2003 |
1088 | ISU-peptide | LQARILAVERYLKDQQL | 17 | L | None | None | None | Linear | Protein Derived | HIV-1 isolate HXB2 | IL-2 | HIV env 583-599 conjugated to a carrier protein to inhibit the cytopathic effect of HIV-1. This inhibition of vims replication may be due to blocking of a secondary receptor, to inhibition of target cell proliferation preventing virus replication or to both effects | Both | Murine CTL-6, human T-cell lines MT4, Molt4/clone 8 | NA | Balb/c mice | Lymphocyte Proliferation assays, cytopathogenicity assay | NA | NA | 7986401 | 1994 |
1089 | Cyclosporin A (CyA) | cyclo[Abu-Sar-N(Me)Leu-Val-N(Me)Leu-Ala-D-Ala-N(Me)Leu-N(Me)Leu-N(Me)Val-N(Me)Bmt(E)] | 11 | Mix | None | None | Bmt = butenyl-methyl-threonine, Abu = L-alpha-aminobutyric acid, Sar = sarcosine, N(Me) = Amino acid is N-methylated | Cyclic | Natural | Fungi | IL-1, IL-8, TNF-α | Inhibits the expression of cytokine genes; lower the activity of T cells and their immune response | In vitro | Murine KC line PAM 212,human squamous carcinoma line COLO-16 | 4.5micromolar | NA | Thymocyte co-stimulator assay | NA | NA | 8148271 | 1994 |
1090 | Cyclosporin A (CyA) | cyclo[Abu-Sar-N(Me)Leu-Val-N(Me)Leu-Ala-D-Ala-N(Me)Leu-N(Me)Leu-N(Me)Val-N(Me)Bmt(E)] | 11 | Mix | None | None | Bmt = butenyl-methyl-threonine, Abu = L-alpha-aminobutyric acid, Sar = sarcosine, N(Me) = Amino acid is N-methylated | Cyclic | Natural | Fungi | IL-1, lL-8, TNF-α | Inhibits the expression of cytokine genes; lower the activity of T cells and their immune response | In vitro | Normal human KCs | 2micromolar | NA | Thymocyte co-stimulator assay | NA | NA | 8148271 | 1994 |
1091 | Transforming growth factor beta 1 (TGFβ1) | not available | 0 | L | None | None | None | Linear | Protein Derived | Human melanoma cell line | IL-7 | The immunosuppressive peptide TGFβ1 was inhibited in a human melanoma cell line transduced with IL-7 | Both | M- 14 and M-24 | NA | Congenitally athymic (nu/nu) BALB/c mice | TGFβ1 bioassay | NA | NA | 8260705 | 1993 |
1092 | CKS-17 | LQNRRGLD | 8 | L | None | None | None | Linear | Protein Derived | murine leukemia virus pl5E TM protein | NA | Unknown | In vitro | Normal brain tissue, kidney, lymphocytes, cultured embryonic lung cells, rhabdomyosarcoma cell line | NA | NA | Evolutionary conservation and PCR-based assay | NA | NA | 8419641 | 1992 |
1093 | HLA-A2 (56-69) | QFVRFDSDAASQRM | 14 | L | None | None | None | Linear | Protein Derived | MHC molecule | NA | NA | Both | NA | NA | LEW rat | Graft transplation assay | NA | NA | 8573307 | 1995 |
1094 | HLA-A2 (60-84) | FDSDAASQRMEPRAPWIEQEGPEYW | 25 | L | None | None | None | Linear | Protein Derived | MHC molecule | NA | NA | Both | NA | NA | LEW rat | Graft transplation assay | NA | NA | 8573307 | 1995 |
1095 | HLA-A2 (98-113) | HRVDLGTLRGYYNQSE | 16 | L | None | None | None | Linear | Protein Derived | MHC molecule | NA | NA | Both | NA | NA | LEW rat | Graft transplation assay | NA | NA | 8573307 | 1995 |
1096 | HLA-A2 (222-235) | EATLRCWALSFYPA | 14 | L | None | None | None | Linear | Protein Derived | MHC molecule | NA | NA | Both | NA | NA | LEW rat | Graft transplation assay | NA | NA | 8573307 | 1995 |
1097 | HLA-B2702 (75-84) | WIEQEGPEYW | 10 | L | None | None | None | Linear | Protein Derived | MHC molecule | NA | NA | Both | NA | NA | LEW rat | T cell assay | NA | NA | 8573307 | 1995 |
1098 | HLA-B38 (75-84) | WIEQEGPEYW | 10 | L | None | None | None | Linear | Protein Derived | MHC molecule | NA | NA | Both | NA | NA | LEW rat | Graft transplation assay | NA | NA | 8573307 | 1995 |
1099 | gp41 portion of gp160 peptide | LSVWGIRQLRARLLALE | 17 | L | None | None | None | Linear | Protein Derived | GP160 protein of HIV | NA | Induced progressive inhibition of PHA-induced lymphocyte proliferation | Both | CTLL-2, murine IL-2-dependent cell line | NA | Balb/c mice, 4-12 months old | Proliferation assay | NA | Interferon α, PGE 2 | 8582788 | 1995 |
1100 | Recombinant Soluble HIV-I GP41 (539-684) | VQARQLLSGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARILAVERYLKDQQLLGIWGCSGKLICTTAVPWNASWSNKSLEQIWNNMTWMEWDREINNYTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWFNITNWLWYIKL | 146 | L | None | None | None | Linear | Protein Derived | HIV-l (derived from clone BH10) | mitogen (Con A, PHA) | Inhibits mitogen-(Con A and PHA) and antigen-(tetanus toxaid)-induced lymphocyte proliferation. It also inhibits the spontaneous cell proliferation of human T, B and monocytic cell lines. | In vitro | Human H9, Jurkat, Raji, Daudi. U937 and HEF cell lines | 8micromolar | NA | BrdU-Labeling and Detection-Kit | NA | NA | 8847089 | 1995 |
1101 | Recombinant Soluble HIV-2 GP36 (565-581) | LRLTVWGTKNLQARVTA | 17 | L | None | None | None | Linear | Protein Derived | HIV-2 (derived from clone ROD) | Con A | Inhibits Con A and protein kinase C (PKC) activity | In vitro | Human H9, Jurkat, Raji, Daudi. U937 and HEF cell lines | NA | NA | BrdU-Labeling and Detection-Kit | NA | NA | 8847089 | 1995 |
1102 | ISP-GP41 (583-599) | VERYLKDQQLLGIWGCS | 17 | L | None | None | None | Linear | Protein Derived | HIV-l (derived from clone BH10) | Con A | Inhibits protein kinase C (PKC) activity | In vitro | Human H9, Jurkat, Raji, Daudi. U937 and HEF cell lines | NA | NA | BrdU-Labeling and Detection-Kit | NA | NA | 8847089 | 1995 |
1103 | HIV-1 gp41 (conjugated with BSA) | LQARILAVERYLKDQQL | 17 | L | None | None | None | Linear | Protein Derived | HIV-1 isolate IIIB | NA | Mimics the effect of human IFN-α and -β on regulation of human MHC class I expression | In vitro | Human H9, Jurkat, Raji, Daudi. U937 and HEF cell lines | NA | NA | NA | NA | NA | 9373217 | 1997 |
1104 | HIV-1 soluble gp41 (sgp41) (539-684) | VQARQLLSGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARILAVERYLKDQQLLGIWGCSGKLICTTAVPWNASWSNKSLEQIWNHTTWMEWDREINNYTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWFNITNWLWYIKI | 146 | L | None | None | None | Linear | Protein Derived | HIV-1 isolate IIIB | NA | Enhances MHC class I expression | In vitro | Human H9, Jurkat, Raji, Daudi. U937 and HEF cell lines | NA | NA | NA | NA | NA | 9373217 | 1997 |
1105 | Heme oxygenase-1 (HO-1) Peptide D2702.75-84 | RENLRIALRY | 10 | L | None | None | None | Linear | Protein Derived | α1-helix of HLA-B2702 | HSC70 and HSP70 | Not Available | Both | Human T cell leukemia cell line Jurkat (clone E6-1) and a mouse lymphoma cell line Yac-1 | NA | Male, 7-8-week-old CBA/J (H-2k) and C57BL/6/J (H-2b) mice | NA | NA | NA | 9446574 | 1997 |
1106 | Heme oxygenase-1 (HO-1) Peptide D2702.75-84(E-V) | rvnlrialry | 10 | D | None | None | None | Linear | Protein Derived | α1-helix of HLA-B2703 | NA | Not Available | Both | Human T cell leukemia cell line Jurkat (clone E6-1) and a mouse lymphoma cell line Yac-2 | NA | C57Bl/6 and CBA mice | NA | NA | NA | 9446574 | 1997 |
1107 | HAP-1 | SFHQFARATLAS | 12 | L | Addition of Cysteine | None | None | Linear | Synthetic | M13 peptide phage library of a rabbit synovial fibroblast cell line | NA | Not Available | In vivo | NA | NA | Female Wistar rat | NA | NA | NA | 245138095 | 2014 |
1108 | Core peptide (CP) | GLRILLLKV | 9 | L | None | None | None | Linear | Synthetic | NA | NA | Not Available | In vivo | NA | NA | Female Wistar rat | NA | NA | NA | 245138095 | 2014 |
1109 | Scrambled HAP-1 peptide (scHAP1) | ALSQAFRHAFTS | 12 | L | Addition of Cysteine | None | None | Linear | Synthetic | NA | NA | Not Available | In vivo | NA | NA | Female Wistar rat | NA | NA | NA | 245138095 | 2014 |
1111 | Collutellin A | VISIIPV | 7 | L | None | None | None | Cyclic | Natural | Colletotrichum dematium (fungus) | IL-2 | Reduces IL2 production | In vitro | C57/B6 mice spleen cells | 167.3+/-0.38 nM | C57/B6 mice | NA | NA | NA | 24333193 | 2014 |
1112 | Antamides | VPPAFFPPFF | 10 | L | None | None | None | Cyclic | Natural | Amanita phalloides spp. (fungus) | NA | Inhibition of mitochondrial permeability transition pores | Both | fibroblasts | NA | C57BL/6 mice | NA | NA | NA | 24333193 | 2014 |
1113 | Cyclosporin A | cyclo[Abu-Sar-N(Me)Leu-Val-N(Me)Leu-Ala-D-Ala-N(Me)Leu-N(Me)Leu-N(Me)Val-N(Me)Bmt(E)] | 11 | Mix | None | None | Bmt = butenyl-methyl-threonine, Abu = L-alpha-aminobutyric acid, Sar = sarcosine, N(Me) = Amino acid is N-methylated | Cyclic | Natural | Tolypocladium inflatum (fungus) | Calcineurin | Inhibition of calcineurin by complex with cyclophilins | Both | Murine KC line PAM 212,human squamous carcinoma line COLO-16 | NA | Sprague Dawley rats | NA | NA | NA | 24333193 | 2014 |
1114 | Didemnin A/B | not available | 0 | L | None | None | None | Cyclic | Natural | Trididemnum solidum (tunicate) | eEFA1 and PPT-1 | Blocks protein and RNA synthesis, binds to eEFA1 and PPT-1 | In vivo | NA | NA | NA | NA | NA | NA | 24333193 | 2014 |
1115 | FK506 (tracrolimus) Ascomycin (pimecrolimus,SDZ ASM 981) | not available | 0 | L | None | None | None | Cyclic | Natural | Streptomyces tsukubaensis (bacteria) | Calcineurin | Inhibition of calcineurin by complex with FK binding proteins | Both | NA | NA | NA | NA | NA | NA | 24333193 | 2014 |
1116 | Homophymines | not available | 0 | L | None | None | None | Cyclic | Natural | Homophymia spp. (marine sponge) | NA | Antiproliferative, mechanism unknown | In vitro | NA | NA | NA | NA | NA | NA | 24333193 | 2014 |