| ID | PEPTIDE SEQUENCE | PEPTIDE NAME | LENGTH | CHIRALITY | LINEAR/CYCLIC | SOURCE | CATEGORY | N TERMINAL MODIFICATION | C TERMINAL MODIFICATION | CHEMICAL MODIFICATION | CARGO | PUBMED ID |
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 2418 | GYGYGYGYGYGYGYGYKKRKKRKKRKKRKQQKQQKRRK | AcD4 | 38 | L | Linear | Synthetic | Cationic | Acetylation | Amidation | NA | Fluorophore [5(6)-carboxyfluorescein] | 24870379 |
| 2419 | AGYLLGKINLKALAALAKKIL | TP10 | 21 | L | Linear | Chimeric | Amphipathic | Free | Amidation | NA | Fluorophore [5(6)-carboxyfluorescein] | 24870379 |
| 2420 | ALALALALALALALALKIKKIKKIKKIKKLAKLAKKIK | D5 | 38 | L | Linear | Synthetic | Cationic | Free | Amidation | NA | Fluorophore [5(6)-carboxyfluorescein] | 24870379 |
| 2421 | LALALALALALALALAKKLKKLKKLKKLKKLKKLKYAK | D6 | 38 | L | Linear | Synthetic | Cationic | Free | Amidation | NA | Fluorophore [5(6)-carboxyfluorescein] | 24870379 |
| 2422 | LALALALALALALALAKKLKKLKKLKKLKKLKKLKYAK | AcD6 | 38 | L | Linear | Synthetic | Cationic | Acetylation | Amidation | NA | Fluorophore [5(6)-carboxyfluorescein] | 24870379 |
| 2423 | IKIKIKIKIKIKIKIKKLAKLAKLAKLAKLAKLAKKIK | D7 | 38 | L | Linear | Synthetic | Cationic | Free | Amidation | NA | Fluorophore [5(6)-carboxyfluorescein] | 24870379 |
| 2424 | IKIKIKIKIKIKIKIKKLAKLAKLAKLAKLAKLAKKIK | AcD7 | 38 | L | Linear | Synthetic | Cationic | Acetylation | Amidation | NA | Fluorophore [5(6)-carboxyfluorescein] | 24870379 |
| 2425 | LALALALALALALALAKIKKIKKIKKIKKLAKLAKKIK | D8 | 38 | L | Linear | Synthetic | Cationic | Free | Amidation | NA | Fluorophore [5(6)-carboxyfluorescein] | 24870379 |
| 2426 | LALALALALALALAKLAKLAKLAKLAKIKKIKKKIK | D9 | 36 | L | Linear | Synthetic | Cationic | Free | Amidation | NA | Fluorophore [5(6)-carboxyfluorescein] | 24870379 |
| 2427 | LALALALALALALALAKLAKLAKLAKLAKLAKKIK | D10 | 35 | L | Linear | Synthetic | Cationic | Free | Amidation | NA | Fluorophore [5(6)-carboxyfluorescein] | 24870379 |
| 2428 | LLIILRRRIRKQAHAHSK | pVEC | 18 | L | Linear | Protein derived | Amphipathic | Free | Amidation | NA | Fluorophore [5(6)-carboxyfluorescein] | 24870379 |
| 2429 | LILILILILILILILIKRKKRKKRKKRKKRAKRAKHSK | D11 | 38 | L | Linear | Synthetic | Cationic | Free | Amidation | NA | Fluorophore [5(6)-carboxyfluorescein] | 24870379 |
| 2430 | LILILILILILILILIKRKKRKKRKKRKKRAKRAKHSK | AcD11 | 38 | L | Linear | Synthetic | Cationic | Acetylation | Amidation | NA | Fluorophore [5(6)-carboxyfluorescein] | 24870379 |
| 2431 | RKKRRQRRR | FabRev1-Tat | 9 | L | Linear | Synthetic | Cationic | Fused with protein C-terminus | Free | NA | Protein (Rev) | 24878961 |
| 2432 | GRKKRRQRRRCG | Tat-CG | 12 | L | Linear | Synthetic | Cationic | Free | Free | NA | Nucleic acid [FAM-siRNA (1 g) in combination with MPEG-PCL] | 24708261 |
| 2433 | LKKLLKLLKKLLKLAG | LK-1 | 16 | L | Linear | Synthetic | Cationic | Acetylation | Amidation | NA | Fluorophore (FITC) | 25056130 |
| 2434 | LKKLCKLLKKLCKLAG | LK-2 | 16 | L | Linear | Synthetic | Cationic | Acetylation | Amidation | NA | Fluorophore (FITC) | 25056130 |
| 2435 | RRRRRRRRR | R9 | 9 | L | Linear | Synthetic | Cationic | Acetylation | Amidation | NA | Fluorophore (FITC) | 25056130 |
| 2436 | VTPHHVLVDEYTGEWVDSQFK | VG-21 | 21 | L | Linear | Protein derived | NA | Free | Free | NA | Fluorophore (FITC) | 25154664 |
| 2437 | RRRRWWWW | [R4W4]Cyclic | 8 | L | Cyclic | Synthetic | Positive charge and hydrophobic moiety, amphiphilic | Conjugation with fluorescein | Cyclization | NA | Fluorophore (Fluorescein) | 25157458 |
| 2438 | AGYLLGKINLKALAALAKKIL | PF3 | 21 | L | Linear | Synthetic | Amphipathic | Stearylation | Conjugation with FAM to ε-NH2 group of additional lysine | NA | Nucleic acid (pGL3, siRNA, SCO) | 25135660 |
| 2439 | AGYLLGKTNLKALAALAKKIL | NF1 | 21 | L | Linear | Synthetic | Amphipathic | Stearylation | Conjugation with FAM to ε-NH2 group of additional lysine | NA | Nucleic acid (pGL3, siRNA, SCO) | 25135660 |
| 2441 | YGRKKRRQRRR | PNIPAM-FL-TAT Peptide | 11 | L | Linear | Protein derived | Cationic | Conjugated with PNIPAM-FL molecule | Free | NA | Nanoparticle [poly(N-isopropylacrylamide) (PNIPAM) microgel particles] | 25170605 |
| 2442 | KRKRWHW | Trehalose-KRKRWHW-Heparin | 7 | L | Linear | Synthetic | Cationic | NA | Conjugation with FITC | NA | Trehalose | 24583082 |
| 2443 | HEHEHEHEHE-PEG-PLA | HEO | 10 | L | Linear | Synthetic | Cationic | Free | Conjugation with PEG-PLA | NA | Fluorophore (Coumarin-6) and small molecule drug (Docetaxel) | 24614579 |
| 2444 | RGRGRGRGRG-PEG-PLA | RGO | 10 | L | Linear | Synthetic | Cationic | Free | Conjugation with PEG-PLA | NA | Fluorophore (Coumarin-6) and small molecule drug (Docetaxel) | 24614579 |
| 2445 | mPEG-PLA-HEHEHEHEHE | HEI | 10 | L | Linear | Synthetic | Cationic | Conjugated with PEG-PLA | Free | NA | Fluorophore (Coumarin-6) and small molecule drug (Docetaxel) | 24614579 |
| 2446 | mPEG-PLA-RGRGRGRGRG | RGI | 10 | L | Linear | Synthetic | Cationic | Conjugated with PEG-PLA | Free | NA | Fluorophore (Coumarin-6) and small molecule drug (Docetaxel) | 24614579 |
| 2447 | RRIRPRPPRLPRPRPRPLPFPRPG | p21-ELP1-Bac | 24 | L | Linear | Synthetic | NA | Conjugated with p21-ELP1 | Free | NA | Peptide (p21-ELP) | 24680816 |
| 2448 | YGRKKRRQRRR | SP-TatCherry | 11 | L | Linear | Synthetic | Amphipathic | Coupled to signal peptide | Conjugation with mCherry | NA | Fluorophore (mCherry) | 24928321 |
| 2449 | YGRKKRRQRRRYGRKKRRQRRRYGRKKRRQRRR | SP-Tatm3xCherry | 33 | L | Linear | Synthetic | Amphipathic | Coupled to signal peptide | Conjugation with mCherry | NA | Fluorophore (mCherry) | 24928321 |
| 2450 | RQIKIWFQNRRMKWKK | Penetratin | 16 | L | Linear | Protein derived | Cationic and amphipathic | Free | Free | NA | Protein (Insulin) | 24973720 |
| 2452 | GGVCPKILKKCRRDSDCPGACICRGNGYCGSGSD | MCoTI-II | 34 | L | Cyclic | Synthetic | Cationic | Conjugation with Alexa Flour 488 | Free | NA | Fluorophore (Alexa Fluor 488) | 24985034 |
| 2453 | GGVCPKILKKCRRDSDCPGACICRGNGWCGSGSD | MCoTI-M1 | 34 | L | Cyclic | Synthetic | Cationic | Conjugation with Alexa Flour 488 | Free | NA | Fluorophore (Alexa Fluor 488) | 24985034 |
| 2454 | GGVCPKILRRCRRDSDCPGACICRGNGYCGSGSD | MCoTI-M2 | 34 | L | Cyclic | Synthetic | Cationic | Conjugation with Alexa Flour 488 | Free | NA | Fluorophore (Alexa Fluor 488) | 24985034 |
| 2455 | GGVCPKILRRCRRDSDCPGACICRGNGWCGSGSD | MCoTI-M3 | 34 | L | Cyclic | Synthetic | Cationic | Conjugation with Alexa Flour 488 | Free | NA | Fluorophore (Alexa Fluor 488) | 24985034 |
| 2456 | GGVCPKILRRCRRDSDCPGACICRGNGYCGSGSR | MCoTI-M4 | 34 | L | Cyclic | Synthetic | Cationic | Conjugation with Alexa Flour 488 | Free | NA | Fluorophore (Alexa Fluor 488) | 24985034 |
| 2457 | GGVCPRILRRCRRDSDCPGACICRGNGYCGSGSK | MCoTI-M5 | 34 | L | Cyclic | Synthetic | Cationic | Conjugation with Alexa Flour 488 | Free | NA | Fluorophore (Alexa Fluor 488) | 24985034 |
| 2458 | GGVCPKILKKCRRDSDCPGACICRGNGYCGSGSD | MCoTI-M6 | 34 | L | Cyclic | Synthetic | Cationic | Conjugation with Alexa Flour 488 | Free | NA | Fluorophore (Alexa Fluor 488) | 24985034 |
| 2459 | GRCTKSIPPICFPD | SFTI-1 | 14 | L | Cyclic | Synthetic | NA | Conjugation with Alexa Flour 488 | Free | NA | Fluorophore (Alexa Fluor 488) | 24985034 |
| 2461 | GACTKSIPPICFPD | SFTI-M1 | 14 | L | Cyclic | Synthetic | NA | Conjugation with Alexa Flour 488 | Free | NA | Fluorophore (Alexa Fluor 488) | 24985034 |
| 2462 | GRCTKSIPPICFPA | SFTI-M2 | 14 | L | Cyclic | Synthetic | Cationic | Conjugation with Alexa Flour 488 | Free | NA | Fluorophore (Alexa Fluor 488) | 24985034 |
| 2463 | GRCTKSIPPICWPD | SFTI-M3 | 14 | L | Cyclic | Synthetic | NA | Conjugation with Alexa Flour 488 | Free | NA | Fluorophore (Alexa Fluor 488) | 24985034 |
| 2464 | GRCTKSIPPICWPK | SFTI-M4 | 14 | L | Cyclic | Synthetic | Cationic | Conjugation with Alexa Flour 488 | Free | NA | Fluorophore (Alexa Fluor 488) | 24985034 |
| 2465 | GRCTRSIPPKCWPD | SFTI-M5 | 14 | L | Cyclic | Synthetic | Cationic | Conjugation with Alexa Flour 488 | Free | NA | Fluorophore (Alexa Fluor 488) | 24985034 |
| 2468 | YGRKKRRQRRRPPQG | TAT | 15 | L | Linear | Protein derived | Cationic | Conjugation with Alexa Flour 488 | Free | NA | Fluorophore (Alexa Fluor 488) | 24985034 |
| 2469 | WEARLARALARALARHLARALARALRACEA | RALA | 30 | L | Linear | Synthetic | Cationic and amphipathic | Free | Free | NA | Nanoparticle (Cy3-labeled nanoparticles complexed with DNA) | 24995949 |
| 2470 | VSRRRRRRGGRRRR | C24-LMWP | 14 | L | Linear | Protein derived | Cationic | Free | Free | NA | Nanoparticle (LMWP/PLGA nanoparticles), Small molecule drug (Doxorubicin) | 25003794 |
| 2471 | HSDAVFTDNYTALRKQMAVKKYLNSILNYGRKKRRQRRR | VIP-TAT | 39 | L | Linear | Protein derived | Cationic | Conjugated with VIP | Free | NA | Fluorophore (FITC) | 25086267 |
| 2472 | RRRRRRRRRRR | Cys(BSH)-Arg11-NH2 | 11 | L | Linear | Synthetic | Cationic | Addition of cysteine and BSH | Amidation | NA | BSH | 24452095 |