Browse result page of AntiTbPdb
The total number entries retrieved from this search are 650
ID | Name | Sequence | N-Terminal Modification | C-Terminal Modification | Chemical Modification | Linear/Cyclic | Length | Chirality | Nature | Source | Origin | Species | Strain | Inhibition Concentration | In vitro/ In vivo | Cell Line | Intracellular Inhibition | Cytotoxicity | Animal Model | Effective Dose in model organism | Immune Responce | Mechanism of Action | Target | Combination Therapy | Other Activities | Year of Publication | Pubmed ID/ Patent No. |
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
antitb_1101 | Seq 39 | RLWRIVVIRVKR | Free | Free | None | Linear | 12 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv, and the Mycobacterium tuberculosis lux strain | MIC90 = 25.9 μM | In vitro | THP-1 cells | NA | For THP-1 (infected wth M.tb) IC50 = 69.2 μM | None | NA | NA | NA | NA | None | Antibacterial and Antifungal (P. aeruginosa, Escherichia coli, Salmonella enterica serovar Typhimurium, Candida albicans, Streptococcus epidermidis, Staphylococcus aureus, and Enterococcus faecalis) | 2013 | 23478953 |
antitb_1102 | Seq 39 | RLWRIVVIRVKR | Free | Free | None | Linear | 12 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis mc26 | MIC90 = 4.3 μM | In vitro | THP-1 cells | NA | For THP-1 (infected wth M.tb) IC90 = 138.4 μM | None | NA | NA | NA | NA | None | Antibacterial and Antifungal (P. aeruginosa, Escherichia coli, Salmonella enterica serovar Typhimurium, Candida albicans, Streptococcus epidermidis, Staphylococcus aureus, and Enterococcus faecalis) | 2013 | 23478953 |
antitb_1103 | Seq 40 | RLRRIVVIRVFR | Free | Free | None | Linear | 12 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv, and the Mycobacterium tuberculosis lux strain | MIC90 = 29.8 μM | In vitro | THP-1 cells | NA | For THP-1 (infected wth M.tb) IC50 = 158.8 μM | None | NA | NA | NA | NA | None | Antibacterial and Antifungal (P. aeruginosa, Escherichia coli, Salmonella enterica serovar Typhimurium, Candida albicans, Streptococcus epidermidis, Staphylococcus aureus, and Enterococcus faecalis) | 2013 | 23478953 |
antitb_1104 | Seq 40 | RLRRIVVIRVFR | Free | Free | None | Linear | 12 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis mc26 | MIC90 = 5 μM | In vitro | THP-1 cells | NA | For THP-1 (infected wth M.tb) IC90 = 158.8 μM | None | NA | NA | NA | NA | None | Antibacterial and Antifungal (P. aeruginosa, Escherichia coli, Salmonella enterica serovar Typhimurium, Candida albicans, Streptococcus epidermidis, Staphylococcus aureus, and Enterococcus faecalis) | 2013 | 23478953 |
antitb_1105 | Seq 41 | VRLRIRVRVIRK | Free | Free | None | Linear | 12 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv, and the Mycobacterium tuberculosis lux strain | MIC90 = 30.1 μM | In vitro | THP-1 cells | NA | For THP-1 (infected wth M.tb) IC50 = 20.1 μM | None | NA | NA | NA | NA | None | Antibacterial and Antifungal (P. aeruginosa, Escherichia coli, Salmonella enterica serovar Typhimurium, Candida albicans, Streptococcus epidermidis, Staphylococcus aureus, and Enterococcus faecalis) | 2013 | 23478953 |
antitb_1106 | Seq 41 | VRLRIRVRVIRK | Free | Free | None | Linear | 12 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis mc26 | MIC90 = 1.6 μM | In vitro | THP-1 cells | NA | For THP-1 (infected wth M.tb) IC90 = 40.2 μM | None | NA | NA | NA | NA | None | Antibacterial and Antifungal (P. aeruginosa, Escherichia coli, Salmonella enterica serovar Typhimurium, Candida albicans, Streptococcus epidermidis, Staphylococcus aureus, and Enterococcus faecalis) | 2013 | 23478953 |
antitb_1107 | Seq 42 | RRYHWRIYI | Free | Free | None | Linear | 9 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv, and the Mycobacterium tuberculosis lux strain | MIC90 = 33.2 μM | In vitro | THP-1 cells | NA | For THP-1 (infected wth M.tb) IC50 = 176.9 μM | None | NA | NA | NA | NA | None | Antibacterial and Antifungal (P. aeruginosa, Escherichia coli, Salmonella enterica serovar Typhimurium, Candida albicans, Streptococcus epidermidis, Staphylococcus aureus, and Enterococcus faecalis) | 2013 | 23478953 |
antitb_1108 | Seq 42 | RRYHWRIYI | Free | Free | None | Linear | 9 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis mc26 | MIC90 = 16.6 μM | In vitro | THP-1 cells | NA | For THP-1 (infected wth M.tb) IC90 = 176.9 μM | None | NA | NA | NA | NA | None | Antibacterial and Antifungal (P. aeruginosa, Escherichia coli, Salmonella enterica serovar Typhimurium, Candida albicans, Streptococcus epidermidis, Staphylococcus aureus, and Enterococcus faecalis) | 2013 | 23478953 |
antitb_1109 | Seq 43 | RKWKIKWYW | Free | Free | None | Linear | 9 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv, and the Mycobacterium tuberculosis lux strain | MIC90 = 34.5 μM | In vitro | THP-1 cells | NA | For THP-1 (infected wth M.tb) IC50 = 91.9 μM | None | NA | NA | NA | NA | None | Antibacterial and Antifungal (P. aeruginosa, Escherichia coli, Salmonella enterica serovar Typhimurium, Candida albicans, Streptococcus epidermidis, Staphylococcus aureus, and Enterococcus faecalis) | 2013 | 23478953 |
antitb_1110 | Seq 43 | RKWKIKWYW | Free | Free | None | Linear | 9 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis mc26 | MIC90 = 2.9 μM | In vitro | THP-1 cells | NA | For THP-1 (infected wth M.tb) IC90 = 183.8 μM | None | NA | NA | NA | NA | None | Antibacterial and Antifungal (P. aeruginosa, Escherichia coli, Salmonella enterica serovar Typhimurium, Candida albicans, Streptococcus epidermidis, Staphylococcus aureus, and Enterococcus faecalis) | 2013 | 23478953 |
antitb_1111 | Seq 44 | YRLRVKWKW | Free | Free | None | Linear | 9 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv, and the Mycobacterium tuberculosis lux strain | MIC90 = 36 μM | In vitro | THP-1 cells | NA | For THP-1 (infected wth M.tb) IC50 = 191.9 μM | None | NA | NA | NA | NA | None | Antibacterial and Antifungal (P. aeruginosa, Escherichia coli, Salmonella enterica serovar Typhimurium, Candida albicans, Streptococcus epidermidis, Staphylococcus aureus, and Enterococcus faecalis) | 2013 | 23478953 |
antitb_1112 | Seq 44 | YRLRVKWKW | Free | Free | None | Linear | 9 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis mc26 | MIC90 = 1.5 μM | In vitro | THP-1 cells | NA | For THP-1 (infected wth M.tb) IC90 = 191.9 μM | None | NA | NA | NA | NA | None | Antibacterial and Antifungal (P. aeruginosa, Escherichia coli, Salmonella enterica serovar Typhimurium, Candida albicans, Streptococcus epidermidis, Staphylococcus aureus, and Enterococcus faecalis) | 2013 | 23478953 |
antitb_1113 | Seq 45 | WKWRVRVTI | Free | Free | None | Linear | 9 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv, and the Mycobacterium tuberculosis lux strain | MIC90 = 51.5 μM | In vitro | THP-1 cells | NA | For THP-1 (infected wth M.tb) IC50 = 206.0 μM | None | NA | NA | NA | NA | None | Antibacterial and Antifungal (P. aeruginosa, Escherichia coli, Salmonella enterica serovar Typhimurium, Candida albicans, Streptococcus epidermidis, Staphylococcus aureus, and Enterococcus faecalis) | 2013 | 23478953 |
antitb_1114 | Seq 45 | WKWRVRVTI | Free | Free | None | Linear | 9 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis mc26 | MIC90 = 0.8 μM | In vitro | THP-1 cells | NA | For THP-1 (infected wth M.tb) IC90 = 206.0 μM | None | NA | NA | NA | NA | None | Antibacterial and Antifungal (P. aeruginosa, Escherichia coli, Salmonella enterica serovar Typhimurium, Candida albicans, Streptococcus epidermidis, Staphylococcus aureus, and Enterococcus faecalis) | 2013 | 23478953 |
antitb_1115 | Seq 46 | RTKKWIVWI | Free | Free | None | Linear | 9 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv, and the Mycobacterium tuberculosis lux strain | MIC90 = 78.1 μM | In vitro | THP-1 cells | NA | For THP-1 (infected wth M.tb) IC50 = 208.3 μM | None | NA | NA | NA | NA | None | Antibacterial and Antifungal (P. aeruginosa, Escherichia coli, Salmonella enterica serovar Typhimurium, Candida albicans, Streptococcus epidermidis, Staphylococcus aureus, and Enterococcus faecalis) | 2013 | 23478953 |
antitb_1116 | Seq 46 | RTKKWIVWI | Free | Free | None | Linear | 9 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis mc26 | MIC90 = 9.8 μM | In vitro | THP-1 cells | NA | For THP-1 (infected wth M.tb) IC90 = 208.3 μM | None | NA | NA | NA | NA | None | Antibacterial and Antifungal (P. aeruginosa, Escherichia coli, Salmonella enterica serovar Typhimurium, Candida albicans, Streptococcus epidermidis, Staphylococcus aureus, and Enterococcus faecalis) | 2013 | 23478953 |
antitb_1117 | Seq 47 | NWRKLYRRK | Free | Free | None | Linear | 9 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv, and the Mycobacterium tuberculosis lux strain | MIC90 = 109.3 μM | In vitro | THP-1 cells | NA | For THP-1 (infected wth M.tb) IC50 = 174.9 μM | None | NA | NA | NA | NA | None | Antibacterial and Antifungal (P. aeruginosa, Escherichia coli, Salmonella enterica serovar Typhimurium, Candida albicans, Streptococcus epidermidis, Staphylococcus aureus, and Enterococcus faecalis) | 2013 | 23478953 |
antitb_1118 | Seq 47 | NWRKLYRRK | Free | Free | None | Linear | 9 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis mc26 | MIC90 = 38.3 μM | In vitro | THP-1 cells | NA | For THP-1 (infected wth M.tb) IC90 =174.9 μM | None | NA | NA | NA | NA | None | Antibacterial and Antifungal (P. aeruginosa, Escherichia coli, Salmonella enterica serovar Typhimurium, Candida albicans, Streptococcus epidermidis, Staphylococcus aureus, and Enterococcus faecalis) | 2013 | 23478953 |
antitb_1119 | Seq 48 | YKFRWRIYI | Free | Free | None | Linear | 9 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv, and the Mycobacterium tuberculosis lux strain | MIC90 = 130 μM | In vitro | THP-1 cells | NA | For THP-1 (infected wth M.tb) IC50 =173.3 μM | None | NA | NA | NA | NA | None | Antibacterial and Antifungal (P. aeruginosa, Escherichia coli, Salmonella enterica serovar Typhimurium, Candida albicans, Streptococcus epidermidis, Staphylococcus aureus, and Enterococcus faecalis) | 2013 | 23478953 |
antitb_1120 | Seq 48 | YKFRWRIYI | Free | Free | None | Linear | 9 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis mc26 | MIC90 = 16.2 μM | In vitro | THP-1 cells | NA | For THP-1 (infected wth M.tb) IC90 = 173.3 μM | None | NA | NA | NA | NA | None | Antibacterial and Antifungal (P. aeruginosa, Escherichia coli, Salmonella enterica serovar Typhimurium, Candida albicans, Streptococcus epidermidis, Staphylococcus aureus, and Enterococcus faecalis) | 2013 | 23478953 |
antitb_1121 | Seq 49 | KRKKRFKWW | Free | Free | None | Linear | 9 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv, and the Mycobacterium tuberculosis lux strain | MIC90 = 141 μM | In vitro | THP-1 cells | NA | For THP-1 (infected wth M.tb) IC90 = 188.0 μM | None | NA | NA | NA | NA | None | Antibacterial and Antifungal (P. aeruginosa, Escherichia coli, Salmonella enterica serovar Typhimurium, Candida albicans, Streptococcus epidermidis, Staphylococcus aureus, and Enterococcus faecalis) | 2013 | 23478953 |
antitb_1122 | Seq 49 | KRKKRFKWW | Free | Free | None | Linear | 9 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis mc26 | MIC90 = 8.8 μM | In vitro | THP-1 cells | NA | For THP-1 (infected wth M.tb) IC90 = 188.0 μM | None | NA | NA | NA | NA | None | Antibacterial and Antifungal (P. aeruginosa, Escherichia coli, Salmonella enterica serovar Typhimurium, Candida albicans, Streptococcus epidermidis, Staphylococcus aureus, and Enterococcus faecalis) | 2013 | 23478953 |
antitb_1132 | Human neutrophil defensin (HNP-1) | ACYCRIPACIAGERRYGTCIYQGRLWAFCC | Free | Free | Internal disulphide bond (cys2-cys30, cys4-cys19,cys9-cys29) | Cyclic | 30 | L | Cationic | Protein Derived | From the human defensin protein found in granules of neutrophils. | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv (ATCC 25618) | 50 mg/L causes approx 70 % growth inhibition | In vitro | None | NA | NA | None | NA | NA | Disrupt the membrane architecture | Cell envelope | None | Antibacterial against salmonella, staphylococcus and neisseria | 2001 | 11328767 |
antitb_1133 | Human neutrophil defensin (HNP-1) | ACYCRIPACIAGERRYGTCIYQGRLWAFCC | Free | Free | Internal disulphide bond (cys2-cys30, cys4-cys19,cys9-cys29) | Cyclic | 30 | L | Cationic | Protein Derived | From the human defensin protein found in granules of neutrophils. | Mycobacterium tuberculosis | Mycobacterium tuberculosis E1380/94 MDR (Isoniazid, rifampicin, streptomycin, ethambutol) strain | 50 mg/L causes approx 30 % growth inhibition | In vitro | None | NA | NA | None | NA | NA | Disrupt the membrane architecture | Cell envelope | None | Antibacterial against salmonella, staphylococcus and neisseria | 2001 | 11328767 |
antitb_1134 | Protegrin-1 (PG-1) | RGGRLCYCRRRFCVCVGR | Free | Free | Internal disulphide bond (between Cys 6-15 and Cys 8-13) | Cyclic | 18 | L | Cationic | Natural | Isolated from porcine leukocytes | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv (ATCC 25618) | 50 mg/L causes approx 65 % growth inhibition | In vitro | None | NA | NA | None | NA | NA | Disrupt the membrane architecture | Cell envelope | None | Antibacterial against salmonella, staphylococcus and neisseria | 2001 | 11328767 |
antitb_1135 | Protegrin-1 (PG-1) | RGGRLCYCRRRFCVCVGR | Free | Free | Internal disulphide bond (between Cys 6-15 and Cys 8-13) | Cyclic | 18 | L | Cationic | Natural | Isolated from porcine leukocytes | Mycobacterium tuberculosis | Mycobacterium tuberculosis E1380/94 MDR (Isoniazid, rifampicin, streptomycin, ethambutol) strain | 50 mg/L causes approx 39 % growth inhibition | In vitro | None | NA | NA | None | NA | NA | Disrupt the membrane architecture | Cell envelope | None | Antibacterial against salmonella, staphylococcus and neisseria | 2001 | 11328767 |
antitb_1140 | LLKKK-18 | KEFKRIVKRIKKFLRKL | Free | Free | None | Linear | 17 | L | Amphipathic | Protein Derived | Variant of LL-37 | Mycobacterium smegmatis | Mycobacterium smegmatis mc2155 (ATCC 700084) | 25 μg of LLKKK-18/ml killed >80% of M. smegmatis after 24 h | In vitro | RAW264.7 | No significant reduction in intracellular survival of M. smegmatis was observed | No significant reduction in cell viability upto 25 μg/ml | None | NA | NA | Permeabilization of the bacterial cell membrane | Cell envelope | None | None | 2013 | 23689720 |
antitb_1141 | LLKKK-18 | KEFKRIVKRIKKFLRKL | Free | Free | None | Linear | 17 | L | Amphipathic | Protein Derived | Variant of LL-38 | Mycobacterium smegmatis | Mycobacterium smegmatis mc2155 (ATCC 700084) | 0.5 ppm of NP-1 combined with 1 μg/ml of LLKKK-18 kills 50% of M. smegmatis | In vitro | RAW264.7 | NP-1 in combination with LLKKK-18 kills 65% of mycobacteria compared to NP-1 or LLKKK-18 alone. | No significant reduction in cell viability either treating alone or combination | None | NA | NA | Permeabilization of the bacterial cell membrane | Cell envelope | AgNPs synthesiszed only in the presence of a plant Alstonia macrophylla (NP-1). | None | 2013 | 23689720 |
antitb_1142 | LLKKK-18 | KEFKRIVKRIKKFLRKL | Free | Free | None | Linear | 17 | L | Amphipathic | Protein Derived | Variant of LL-39 | Mycobacterium smegmatis | Mycobacterium smegmatis mc2155 (ATCC 700084) | 0.5 ppm of NP-2 combined with 1 μg/ml of LLKKK-18 kills 89% of M. smegmatis | In vitro | RAW264.7 | No significant reduction | No significant reduction in cell viability either treating alone or combination | None | NA | NA | Permeabilization of the bacterial cell membrane | Cell envelope | AgNPs synthesiszed only in the presence of a fungal Trichoderma sp. (NP-2). | None | 2013 | 23689720 |
antitb_1143 | LLKKK-18 | KEFKRIVKRIKKFLRKL | Free | Free | None | Linear | 17 | L | Amphipathic | Protein Derived | Variant of LL-40 | Mycobacterium marinum | Mycobacterium marinum (ATCC 927) | IC 90 = 1 μg/ml | In vitro | RAW264.7 | Moderate killing was observed | No significant reduction in cell viability either treating alone or combination | None | NA | NA | Permeabilization of the bacterial cell membrane | Cell envelope | None | None | 2013 | 23689720 |
antitb_1144 | Nisin A | I-(Dhb)-AI-(Dha)-LA-(Abu)-PGAK-(Abu)-GALMGANMK-(Abu)-A-(Abu)-ANASIHV-(Dha)-K | Free | Free | Dha= Didehydroalanine, Dhb= Didehydroaminobutyric acid, Abu= 2-aminobutyric acid, Lanthionine (Ala-S-Ala) formation from 3-7 Ala, and β-methyllanthionine (Abu-S-Ala) from 8-11, 13-19, 23-26, 25-28 in between Abu and Ala | Cyclic (5 hinge region due to presence of lanthion | 34 | L | NA | Natural | Produced by Lactococcus lactis | Mycobacterium smegmatis | Mycobacterium smegmatis mc2155 | NA | In vitro | None | NA | NA | None | NA | NA | NA | NA | None | Antibacterial (Shigella, Pseudomonas and Salmonella, S. aureus, S. agalactiae and L. monocytogenes) | 2010 | 21468208 |
antitb_1145 | Nisin A | I-(Dhb)-AI-(Dha)-LA-(Abu)-PGAK-(Abu)-GALMGANMK-(Abu)-A-(Abu)-ANASIHV-(Dha)-K | Free | Free | Dha= Didehydroalanine, Dhb= Didehydroaminobutyric acid, Abu= 2-aminobutyric acid, Lanthionine (Ala-S-Ala) formation from 3-7 Ala, and β-methyllanthionine (Abu-S-Ala) from 8-11, 13-19, 23-26, 25-28 in between Abu and Ala | Cyclic (5 hinge region due to presence of lanthion | 34 | L | NA | Natural | Produced by Lactococcus lactis | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Ra | NA | In vitro | None | NA | NA | None | NA | NA | NA | NA | None | Antibacterial (Shigella, Pseudomonas and Salmonella, S. aureus, S. agalactiae and L. monocytogenes) | 2010 | 21468208 |
antitb_1146 | Nisin A | I-(Dhb)-AI-(Dha)-LA-(Abu)-PGAK-(Abu)-GALMGANMK-(Abu)-A-(Abu)-ANASIHV-(Dha)-K | Free | Free | Dha= Didehydroalanine, Dhb= Didehydroaminobutyric acid, Abu= 2-aminobutyric acid, Lanthionine (Ala-S-Ala) formation from 3-7 Ala, and β-methyllanthionine (Abu-S-Ala) from 8-11, 13-19, 23-26, 25-28 in between Abu and Ala | Cyclic (5 hinge region due to presence of lanthion | 34 | L | NA | Natural | Produced by Lactococcus lactis | Mycobacterium kansasii | Mycobacterium kansasii CIT11/06 | NA | In vitro | None | NA | NA | None | NA | NA | NA | NA | None | Antibacterial (Shigella, Pseudomonas and Salmonella, S. aureus, S. agalactiae and L. monocytogenes) | 2010 | 21468208 |
antitb_1147 | Nisin A | I-(Dhb)-AI-(Dha)-LA-(Abu)-PGAK-(Abu)-GALMGANMK-(Abu)-A-(Abu)-ANASIHV-(Dha)-K | Free | Free | Dha= Didehydroalanine, Dhb= Didehydroaminobutyric acid, Abu= 2-aminobutyric acid, Lanthionine (Ala-S-Ala) formation from 3-7 Ala, and β-methyllanthionine (Abu-S-Ala) from 8-11, 13-19, 23-26, 25-28 in between Abu and Ala | Cyclic (5 hinge region due to presence of lanthion | 34 | L | NA | Natural | Produced by Lactococcus lactis | Mycobacterium avium | Mycobacterium avium subsp. Hominissuis (CIT05/03) | NA | In vitro | None | NA | NA | None | NA | NA | NA | NA | None | Antibacterial (Shigella, Pseudomonas and Salmonella, S. aureus, S. agalactiae and L. monocytogenes) | 2010 | 21468208 |
antitb_1148 | Nisin A | I-(Dhb)-AI-(Dha)-LA-(Abu)-PGAK-(Abu)-GALMGANMK-(Abu)-A-(Abu)-ANASIHV-(Dha)-K | Free | Free | Dha= Didehydroalanine, Dhb= Didehydroaminobutyric acid, Abu= 2-aminobutyric acid, Lanthionine (Ala-S-Ala) formation from 3-7 Ala, and β-methyllanthionine (Abu-S-Ala) from 8-11, 13-19, 23-26, 25-28 in between Abu and Ala | Cyclic (5 hinge region due to presence of lanthion | 34 | L | NA | Natural | Produced by Lactococcus lactis | Mycobacterium avium | Mycobacterium avium paratuberculosis (ATCC 19698) | NA | In vitro | None | NA | NA | None | NA | NA | NA | NA | None | Antibacterial (Shigella, Pseudomonas and Salmonella, S. aureus, S. agalactiae and L. monocytogenes) | 2010 | 21468208 |
antitb_1149 | Nisin V | I-(Dhb)-AI-(Dha)-LA-(Abu)-PGAK-(Abu)-GALMGANVK-(Abu)-A-(Abu)-ANASIHV-(Dha)-K | Free | Free | Dha= Didehydroalanine, Dhb= Didehydroaminobutyric acid, Abu= 2-aminobutyric acid, Lanthionine (Ala-S-Ala) formation from 3-7 Ala, and β-methyllanthionine (Abu-S-Ala) from 8-11, 13-19, 23-26, 25-28 in between Abu and Ala | Cyclic (5 hinge region dur to presence of lanthion | 34 | L | NA | Natural | Produced by Lactococcus lactis | Mycobacterium smegmatis | Mycobacterium smegmatis MC2155 | 2.2 mm zone of activity as compared to Nisin A | In vitro | None | NA | NA | None | NA | NA | NA | NA | None | Antibacterial (Shigella, Pseudomonas and Salmonella, S. aureus, S. agalactiae and L. monocytogenes) | 2010 | 21468208 |
antitb_1150 | Nisin V | I-(Dhb)-AI-(Dha)-LA-(Abu)-PGAK-(Abu)-GALMGANVK-(Abu)-A-(Abu)-ANASIHV-(Dha)-K | Free | Free | Dha= Didehydroalanine, Dhb= Didehydroaminobutyric acid, Abu= 2-aminobutyric acid, Lanthionine (Ala-S-Ala) formation from 3-7 Ala, and β-methyllanthionine (Abu-S-Ala) from 8-11, 13-19, 23-26, 25-28 in between Abu and Ala | Cyclic (5 hinge region dur to presence of lanthion | 34 | L | NA | Natural | Produced by Lactococcus lactis | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Ra | 10% decrease in relative growth as compared to Nicin A | In vitro | None | NA | NA | None | NA | NA | NA | NA | None | Antibacterial (Shigella, Pseudomonas and Salmonella, S. aureus, S. agalactiae and L. monocytogenes) | 2010 | 21468208 |
antitb_1151 | Nisin V | I-(Dhb)-AI-(Dha)-LA-(Abu)-PGAK-(Abu)-GALMGANVK-(Abu)-A-(Abu)-ANASIHV-(Dha)-K | Free | Free | Dha= Didehydroalanine, Dhb= Didehydroaminobutyric acid, Abu= 2-aminobutyric acid, Lanthionine (Ala-S-Ala) formation from 3-7 Ala, and β-methyllanthionine (Abu-S-Ala) from 8-11, 13-19, 23-26, 25-28 in between Abu and Ala | Cyclic (5 hinge region dur to presence of lanthion | 34 | L | NA | Natural | Produced by Lactococcus lactis | Mycobacterium kansasii | Mycobacterium kansasii CIT11/06 | 20% decrease in relative growth as compared to Nicin A | In vitro | None | NA | NA | None | NA | NA | NA | NA | None | Antibacterial (Shigella, Pseudomonas and Salmonella, S. aureus, S. agalactiae and L. monocytogenes) | 2010 | 21468208 |
antitb_1152 | Nisin V | I-(Dhb)-AI-(Dha)-LA-(Abu)-PGAK-(Abu)-GALMGANVK-(Abu)-A-(Abu)-ANASIHV-(Dha)-K | Free | Free | Dha= Didehydroalanine, Dhb= Didehydroaminobutyric acid, Abu= 2-aminobutyric acid, Lanthionine (Ala-S-Ala) formation from 3-7 Ala, and β-methyllanthionine (Abu-S-Ala) from 8-11, 13-19, 23-26, 25-28 in between Abu and Ala | Cyclic (5 hinge region dur to presence of lanthion | 34 | L | NA | Natural | Produced by Lactococcus lactis | Mycobacterium avium | Mycobacterium avium subsp. Hominissuis (CIT05/03) | 16% decrease in relative growth as compared to Nicin A | In vitro | None | NA | NA | None | NA | NA | NA | NA | None | Antibacterial (Shigella, Pseudomonas and Salmonella, S. aureus, S. agalactiae and L. monocytogenes) | 2010 | 21468208 |
antitb_1153 | Nisin V | I-(Dhb)-AI-(Dha)-LA-(Abu)-PGAK-(Abu)-GALMGANVK-(Abu)-A-(Abu)-ANASIHV-(Dha)-K | Free | Free | Dha= Didehydroalanine, Dhb= Didehydroaminobutyric acid, Abu= 2-aminobutyric acid, Lanthionine (Ala-S-Ala) formation from 3-7 Ala, and β-methyllanthionine (Abu-S-Ala) from 8-11, 13-19, 23-26, 25-28 in between Abu and Ala | Cyclic (5 hinge region dur to presence of lanthion | 34 | L | NA | Natural | Produced by Lactococcus lactis | Mycobacterium avium | Mycobacterium avium paratuberculosis (ATCC 19698) | 23% decrease in relative growth as compared to Nicin A | In vitro | None | NA | NA | None | NA | NA | NA | NA | None | Antibacterial (Shigella, Pseudomonas and Salmonella, S. aureus, S. agalactiae and L. monocytogenes) | 2010 | 21468208 |
antitb_1154 | Nisin S | I-(Dhb)-AI-(Dha)-LA-(Abu)-PGAK-(Abu)-GALMGANMS-(Abu)-A-(Abu)-ANASIHV-(Dha)-K | Free | Free | Dha= Didehydroalanine, Dhb= Didehydroaminobutyric acid, Abu= 2-aminobutyric acid, Lanthionine (Ala-S-Ala) formation from 3-7 Ala, and β-methyllanthionine (Abu-S-Ala) from 8-11, 13-19, 23-26, 25-28 in between Abu and Ala | Cyclic (5 hinge region dur to presence of lanthion | 34 | L | NA | Natural | Produced by Lactococcus lactis | Mycobacterium smegmatis | Mycobacterium smegmatis MC2155 | 4 mm zone of activity as compared to Nisin A | In vitro | None | NA | NA | None | NA | NA | NA | NA | None | Antibacterial (Shigella, Pseudomonas and Salmonella, S. aureus, S. agalactiae and L. monocytogenes) | 2010 | 21468208 |
antitb_1155 | Nisin S | I-(Dhb)-AI-(Dha)-LA-(Abu)-PGAK-(Abu)-GALMGANMS-(Abu)-A-(Abu)-ANASIHV-(Dha)-K | Free | Free | Dha= Didehydroalanine, Dhb= Didehydroaminobutyric acid, Abu= 2-aminobutyric acid, Lanthionine (Ala-S-Ala) formation from 3-7 Ala, and β-methyllanthionine (Abu-S-Ala) from 8-11, 13-19, 23-26, 25-28 in between Abu and Ala | Cyclic (5 hinge region dur to presence of lanthion | 34 | L | NA | Natural | Produced by Lactococcus lactis | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Ra | 26% reductions in growth, relative to that brought about by nisin A | In vitro | None | NA | NA | None | NA | NA | NA | NA | None | Antibacterial (Shigella, Pseudomonas and Salmonella, S. aureus, S. agalactiae and L. monocytogenes) | 2010 | 21468208 |
antitb_1156 | Nisin S | I-(Dhb)-AI-(Dha)-LA-(Abu)-PGAK-(Abu)-GALMGANMS-(Abu)-A-(Abu)-ANASIHV-(Dha)-K | Free | Free | Dha= Didehydroalanine, Dhb= Didehydroaminobutyric acid, Abu= 2-aminobutyric acid, Lanthionine (Ala-S-Ala) formation from 3-7 Ala, and β-methyllanthionine (Abu-S-Ala) from 8-11, 13-19, 23-26, 25-28 in between Abu and Ala | Cyclic (5 hinge region dur to presence of lanthion | 34 | L | NA | Natural | Produced by Lactococcus lactis | Mycobacterium kansasii | Mycobacterium kansasii CIT11/06 | Relative growth was reduced by 29% compared to that which occurred in the presence of nisin A. | In vitro | None | NA | NA | None | NA | NA | NA | NA | None | Antibacterial (Shigella, Pseudomonas and Salmonella, S. aureus, S. agalactiae and L. monocytogenes) | 2010 | 21468208 |
antitb_1157 | Nisin S | I-(Dhb)-AI-(Dha)-LA-(Abu)-PGAK-(Abu)-GALMGANMS-(Abu)-A-(Abu)-ANASIHV-(Dha)-K | Free | Free | Dha= Didehydroalanine, Dhb= Didehydroaminobutyric acid, Abu= 2-aminobutyric acid, Lanthionine (Ala-S-Ala) formation from 3-7 Ala, and β-methyllanthionine (Abu-S-Ala) from 8-11, 13-19, 23-26, 25-28 in between Abu and Ala | Cyclic (5 hinge region dur to presence of lanthion | 34 | L | NA | Natural | Produced by Lactococcus lactis | Mycobacterium avium | Mycobacterium avium subsp. Hominissuis (CIT05/03) | 28% reductions in growth, relative to that brought about by nisin A | In vitro | None | NA | NA | None | NA | NA | NA | NA | None | Antibacterial (Shigella, Pseudomonas and Salmonella, S. aureus, S. agalactiae and L. monocytogenes) | 2010 | 21468208 |
antitb_1158 | Nisin S | I-(Dhb)-AI-(Dha)-LA-(Abu)-PGAK-(Abu)-GALMGANMS-(Abu)-A-(Abu)-ANASIHV-(Dha)-K | Free | Free | Dha= Didehydroalanine, Dhb= Didehydroaminobutyric acid, Abu= 2-aminobutyric acid, Lanthionine (Ala-S-Ala) formation from 3-7 Ala, and β-methyllanthionine (Abu-S-Ala) from 8-11, 13-19, 23-26, 25-28 in between Abu and Ala | Cyclic (5 hinge region dur to presence of lanthion | 34 | L | NA | Natural | Produced by Lactococcus lactis | Mycobacterium avium | Mycobacterium avium paratuberculosis (ATCC 19698) | 19% decrease in growth as compare to the presence of Nicin A | In vitro | None | NA | NA | None | NA | NA | NA | NA | None | Antibacterial (Shigella, Pseudomonas and Salmonella, S. aureus, S. agalactiae and L. monocytogenes) | 2010 | 21468208 |
antitb_1159 | Nisin T | I-(Dhb)-AI-(Dha)-LA-(Abu)-PGAK-(Abu)-GALMGANMT-(Abu)-A-(Abu)-ANASIHV-(Dha)-K | Free | Free | Dha= Didehydroalanine, Dhb= Didehydroaminobutyric acid, Abu= 2-aminobutyric acid, Lanthionine (Ala-S-Ala) formation from 3-7 Ala, and β-methyllanthionine (Abu-S-Ala) from 8-11, 13-19, 23-26, 25-28 in between Abu and Ala | Cyclic (5 hinge region dur to presence of lanthion | 34 | L | NA | Natural | Produced by Lactococcus lactis | Mycobacterium smegmatis | Mycobacterium smegmatis MC2155 | 2.7 mm zone of activity as compared to Nisin A | In vitro | None | NA | NA | None | NA | NA | NA | NA | None | Antibacterial (Shigella, Pseudomonas and Salmonella, S. aureus, S. agalactiae and L. monocytogenes) | 2010 | 21468208 |
antitb_1160 | Nisin T | I-(Dhb)-AI-(Dha)-LA-(Abu)-PGAK-(Abu)-GALMGANMT-(Abu)-A-(Abu)-ANASIHV-(Dha)-K | Free | Free | Dha= Didehydroalanine, Dhb= Didehydroaminobutyric acid, Abu= 2-aminobutyric acid, Lanthionine (Ala-S-Ala) formation from 3-7 Ala, and β-methyllanthionine (Abu-S-Ala) from 8-11, 13-19, 23-26, 25-28 in between Abu and Ala | Cyclic (5 hinge region dur to presence of lanthion | 34 | L | NA | Natural | Produced by Lactococcus lactis | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Ra | 24% more inhibition as compared to nisin A | In vitro | None | NA | NA | None | NA | NA | NA | NA | None | Antibacterial (Shigella, Pseudomonas and Salmonella, S. aureus, S. agalactiae and L. monocytogenes) | 2010 | 21468208 |
antitb_1161 | Nisin T | I-(Dhb)-AI-(Dha)-LA-(Abu)-PGAK-(Abu)-GALMGANMT-(Abu)-A-(Abu)-ANASIHV-(Dha)-K | Free | Free | Dha= Didehydroalanine, Dhb= Didehydroaminobutyric acid, Abu= 2-aminobutyric acid, Lanthionine (Ala-S-Ala) formation from 3-7 Ala, and β-methyllanthionine (Abu-S-Ala) from 8-11, 13-19, 23-26, 25-28 in between Abu and Ala | Cyclic (5 hinge region dur to presence of lanthion | 34 | L | NA | Natural | Produced by Lactococcus lactis | Mycobacterium kansasii | Mycobacterium kansasii CIT11/06 | 24% more inhibition as compared to nisin A | In vitro | None | NA | NA | None | NA | NA | NA | NA | None | Antibacterial (Shigella, Pseudomonas and Salmonella, S. aureus, S. agalactiae and L. monocytogenes) | 2010 | 21468208 |
antitb_1162 | Nisin T | I-(Dhb)-AI-(Dha)-LA-(Abu)-PGAK-(Abu)-GALMGANMT-(Abu)-A-(Abu)-ANASIHV-(Dha)-K | Free | Free | Dha= Didehydroalanine, Dhb= Didehydroaminobutyric acid, Abu= 2-aminobutyric acid, Lanthionine (Ala-S-Ala) formation from 3-7 Ala, and β-methyllanthionine (Abu-S-Ala) from 8-11, 13-19, 23-26, 25-28 in between Abu and Ala | Cyclic (5 hinge region dur to presence of lanthion | 34 | L | NA | Natural | Produced by Lactococcus lactis | Mycobacterium avium | Mycobacterium avium subsp. Hominissuis (CIT05/03) | 16% more inhibition as compared to nisin A | In vitro | None | NA | NA | None | NA | NA | NA | NA | None | Antibacterial (Shigella, Pseudomonas and Salmonella, S. aureus, S. agalactiae and L. monocytogenes) | 2010 | 21468208 |
antitb_1163 | Nisin T | I-(Dhb)-AI-(Dha)-LA-(Abu)-PGAK-(Abu)-GALMGANMT-(Abu)-A-(Abu)-ANASIHV-(Dha)-K | Free | Free | Dha= Didehydroalanine, Dhb= Didehydroaminobutyric acid, Abu= 2-aminobutyric acid, Lanthionine (Ala-S-Ala) formation from 3-7 Ala, and β-methyllanthionine (Abu-S-Ala) from 8-11, 13-19, 23-26, 25-28 in between Abu and Ala | Cyclic (5 hinge region dur to presence of lanthion | 34 | L | NA | Natural | Produced by Lactococcus lactis | Mycobacterium avium | Mycobacterium avium paratuberculosis (ATCC 19698) | 27% decrease in growth relative to nisin A | In vitro | None | NA | NA | None | NA | NA | NA | NA | None | Antibacterial (Shigella, Pseudomonas and Salmonella, S. aureus, S. agalactiae and L. monocytogenes) | 2010 | 21468208 |