Browse result page of AntiTbPdb
The total number entries retrieved from this search are 650
| ID | Name | Sequence | N-Terminal Modification | C-Terminal Modification | Chemical Modification | Linear/Cyclic | Length | Chirality | Nature | Source | Origin | Species | Strain | Inhibition Concentration | In vitro/ In vivo | Cell Line | Intracellular Inhibition | Cytotoxicity | Animal Model | Effective Dose in model organism | Immune Responce | Mechanism of Action | Target | Combination Therapy | Other Activities | Year of Publication | Pubmed ID/ Patent No. |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| antitb_1239 | (LLKK)2C | LLKKLLKKC | Free | Free | None | Linear | 9 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis (ATCC No. 14468) | MIC = 125 mg/L | In vitro | Rat red blood cells (rRBCs) | NA | Very low, i.e. 50% hemolysis concentration (HC50) > 1000 mg/L | None | NA | NA | Membrane-lytic mechanism | Cell envelope | None | Antibacterial | 2014 | 24314557 |
| antitb_1240 | C(LLKK)2C | CLLKKLLKKC | Free | Free | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis (ATCC No. 14468) | MIC = 250 mg/L | In vitro | Rat red blood cells (rRBCs) | NA | Very low, i.e. 50% hemolysis concentration (HC50) > 1000 mg/L | None | NA | NA | Membrane-lytic mechanism | Cell envelope | None | Antibacterial | 2014 | 24314557 |
| antitb_1241 | M(LLKK)2 | MLLKKLLKK | Free | Free | None | Linear | 9 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis (ATCC No. 14468) | MIC = 125 mg/L | In vitro | Rat red blood cells (rRBCs) | NA | Very low, i.e. 50% hemolysis concentration (HC50) > 1000 mg/L | None | NA | NA | Membrane-lytic mechanism | Cell envelope | None | Antibacterial | 2014 | 24314557 |
| antitb_1242 | (LLKK)2M | LLKKLLKKM | Free | Free | None | Linear | 9 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis (ATCC No. 14468) | MIC = 62.5 mg/L | In vitro | Rat red blood cells (rRBCs) | NA | Very low, i.e. 50% hemolysis concentration (HC50) > 1000 mg/L | None | NA | NA | Membrane-lytic mechanism | Cell envelope | None | Antibacterial | 2014 | 24314557 |
| antitb_1243 | (LLKK)2M | LLKKLLKKM | Free | Free | None | Linear | 9 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis resistant agianst rifampicin | MIC = 62.5 mg/L | In vitro | Rat red blood cells (rRBCs) | NA | Very low, i.e. 50% hemolysis concentration (HC50) > 1000 mg/L | None | NA | NA | Membrane-lytic mechanism | Cell envelope | None | Antibacterial | 2014 | 24314557 |
| antitb_1244 | (LLKK)2M | LLKKLLKKM | Free | Free | None | Linear | 9 | L | Cationic | Synthetic | NA | Mycobacterium bovis | Mycobacterium bovis BCG lux | MIC = 500 mg/L | In vitro | Rat red blood cells (rRBCs) | NA | Very low, i.e. 50% hemolysis concentration (HC50) > 1000 mg/L | None | NA | NA | Membrane-lytic mechanism | Cell envelope | None | Antibacterial | 2014 | 24314557 |
| antitb_1245 | (LLKK)2M | LLKKLLKKM | Free | Free | None | Linear | 9 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC > 500 mg/L | In vitro | Rat red blood cells (rRBCs) | NA | Very low, i.e. 50% hemolysis concentration (HC50) > 1000 mg/L | None | NA | NA | Membrane-lytic mechanism | Cell envelope | None | Antibacterial | 2014 | 24314557 |
| antitb_1246 | (LLKK)2M | LLKKLLKKM | Free | Free | None | Linear | 9 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis CSU87 reistant to rifampicin, isoniazid, ethambutol, streptomycin and kanamycin | MIC = 125 mg/L | In vitro | Rat red blood cells (rRBCs) | NA | Very low, i.e. 50% hemolysis concentration (HC50) > 1000 mg/L | None | NA | NA | Membrane-lytic mechanism | Cell envelope | None | Antibacterial | 2014 | 24314557 |
| antitb_1247 | M(LLKK)2M | MLLKKLLKKM | Free | Free | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis (ATCC No. 14468) | MIC = 62.5 mg/L | In vitro | Rat red blood cells (rRBCs) | NA | Very low, i.e. 50% hemolysis concentration (HC50) > 1000 mg/L | None | NA | NA | Membrane-lytic mechanism | Cell envelope | None | Antibacterial | 2014 | 24314557 |
| antitb_1248 | M(LLKK)2M | MLLKKLLKKM | Free | Free | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis (ATCC No. 14468) | MIC = 15.6 mg/L | In vitro | Rat red blood cells (rRBCs) | NA | Very low, i.e. 50% hemolysis concentration (HC50) > 1000 mg/L | None | NA | NA | Membrane-lytic mechanism | Cell envelope | Rifampicin, shows synergy | Antibacterial | 2014 | 24314557 |
| antitb_1249 | M(LLKK)2M | MLLKKLLKKM | Free | Free | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis resistant agianst rifampicin | MIC = 62.5 mg/L | In vitro | Rat red blood cells (rRBCs) | NA | Very low, i.e. 50% hemolysis concentration (HC50) > 1000 mg/L | None | NA | NA | Membrane-lytic mechanism | Cell envelope | None | Antibacterial | 2014 | 24314557 |
| antitb_1250 | M(LLKK)2M | MLLKKLLKKM | Free | Free | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis resistant agianst rifampicin | MIC = 15.6 mg/L | In vitro | Rat red blood cells (rRBCs) | NA | Very low, i.e. 50% hemolysis concentration (HC50) > 1000 mg/L | None | NA | NA | Membrane-lytic mechanism | Cell envelope | Rifampicin, shows synergy | Antibacterial | 2014 | 24314557 |
| antitb_1251 | M(LLKK)2M | MLLKKLLKKM | Free | Free | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium bovis | Mycobacterium bovis BCG lux | MIC = 15.6 mg/L | In vitro | Rat red blood cells (rRBCs) | NA | Very low, i.e. 50% hemolysis concentration (HC50) > 1000 mg/L | None | NA | NA | Membrane-lytic mechanism | Cell envelope | None | Antibacterial | 2014 | 24314557 |
| antitb_1252 | M(LLKK)2M | MLLKKLLKKM | Free | Free | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium bovis | Mycobacterium bovis BCG lux | MIC = 3.91 mg/L | In vitro | Rat red blood cells (rRBCs) | NA | Very low, i.e. 50% hemolysis concentration (HC50) > 1000 mg/L | None | NA | NA | Membrane-lytic mechanism | Cell envelope | Rifampicin, shows synergy | Antibacterial | 2014 | 24314557 |
| antitb_1253 | M(LLKK)2M | MLLKKLLKKM | Free | Free | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 125 mg/L | In vitro | Rat red blood cells (rRBCs) | NA | Very low, i.e. 50% hemolysis concentration (HC50) > 1000 mg/L | None | NA | NA | Membrane-lytic mechanism | Cell envelope | None | Antibacterial | 2014 | 24314557 |
| antitb_1254 | M(LLKK)2M | MLLKKLLKKM | Free | Free | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 7.81 mg/L | In vitro | Rat red blood cells (rRBCs) | NA | Very low, i.e. 50% hemolysis concentration (HC50) > 1000 mg/L | None | NA | NA | Membrane-lytic mechanism | Cell envelope | Rifampicin, shows synergy | Antibacterial | 2014 | 24314557 |
| antitb_1255 | M(LLKK)2M | MLLKKLLKKM | Free | Free | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis CSU87 reistant to rifampicin, isoniazid, ethambutol, streptomycin and kanamycin | MIC = 62.5 mg/L | In vitro | Rat red blood cells (rRBCs) | NA | Very low, i.e. 50% hemolysis concentration (HC50) > 1000 mg/L | None | NA | NA | Membrane-lytic mechanism | Cell envelope | None | Antibacterial | 2014 | 24314557 |
| antitb_1256 | Eosinophil Cationic Protein (RNase 3) | RPPQFTRAQWFAIQHISLNPPRCTIAMRAINNYRWRCKNQNTFLRTTFANVVNVCGNQSIRCPHNRTLNN | Free | Free | Disulphide linkage | Cyclic | 70 | L | Cationic | Natural | Secreted by eosinophil secondary granules | Mycobacterium vaccae | Mycobacterium vaccae strain (ATCC 15483) | MIC = 20.0 ± 1.0 μM | In vitro | None | NA | NA | None | NA | NA | Membrane depolarization and permeabilization | Cell envelope | None | Antibacterial and Antiparasitic | 2013 | 23716047 |
| antitb_1257 | Eosinophil Cationic Protein (RNase 3) | RPPQFTRAQWFAIQHISLNPPRCTIAMRAINNYRWRCKNQNTFLRTTFANVVNVCGNQSIRCPHNRTLNN | Free | Free | Disulphide linkage | Cyclic | 70 | L | Cationic | Natural | Secreted by eosinophil secondary granules | Mycobacterium vaccae | Mycobacterium vaccae strain (ATCC 15483) | IC50 = 11.6 ± 0.2 μM | In vitro | None | NA | NA | None | NA | NA | Membrane depolarization and permeabilization | Cell envelope | None | Antibacterial and Antiparasitic | 2013 | 23716047 |
| antitb_1258 | RNase 7 | KPKGMTSSQWFKIQHMOPSPQACNSAMKNINKHTKRCKDLNTFLHEPFSSVAATCQTPKIACKNGDKN | Free | Free | Disulphide linkage | Cyclic | 68 | L | Cationic | Natural | Secreted by innate cells during host defense | Mycobacterium vaccae | Mycobacterium vaccae strain (ATCC 15483) | MIC = 20.0 ± 0.5 μM | In vitro | None | NA | NA | None | NA | NA | Membrane depolarization and permeabilization | Cell envelope | None | Antibacterial and Antiparasitic | 2013 | 23716047 |
| antitb_1259 | RNase 7 | KPKGMTSSQWFKIQHMOPSPQACNSAMKNINKHTKRCKDLNTFLHEPFSSVAATCQTPKIACKNGDKN | Free | Free | Disulphide linkage | Cyclic | 68 | L | Cationic | Natural | Secreted by innate cells during host defense | Mycobacterium vaccae | Mycobacterium vaccae strain (ATCC 15483) | IC50 = 9.3 ± 1.2 μM | In vitro | None | NA | NA | None | NA | NA | Membrane depolarization and permeabilization | Cell envelope | None | Antibacterial and Antiparasitic | 2013 | 23716047 |
| antitb_1260 | RN3 (1-45) | RPPQFTRAQWFAIQHISLNPPRSTIAMRAINNYRWRSKNQNTFLR | Free | Free | None | Linear | 45 | L | Cationic | Protein Derived | From the N terminus of RNase 3 | Mycobacterium vaccae | Mycobacterium vaccae strain (ATCC 15483) | MIC = 10.0 ± 0.5 μM | In vitro | None | NA | NA | None | NA | NA | Membrane depolarization and permeabilization | Cell envelope | None | Antibacterial and Antiparasitic | 2013 | 23716047 |
| antitb_1261 | RN3 (1-45) | RPPQFTRAQWFAIQHISLNPPRSTIAMRAINNYRWRSKNQNTFLR | Free | Free | None | Linear | 45 | L | Cationic | Protein Derived | From the N terminus of RNase 4 | Mycobacterium vaccae | Mycobacterium vaccae strain (ATCC 15483) | IC50 = 4.2 ± 0.2 μM | In vitro | None | NA | NA | None | NA | NA | Membrane depolarization and permeabilization | Cell envelope | None | Antibacterial and Antiparasitic | 2013 | 23716047 |
| antitb_1262 | RN7 (1-45) | KPKGMTSSQWFKIQHMQPSPQASNSAMKNINKHTKRSKDLNTFLH | Free | Free | None | Linear | 45 | L | Cationic | Protein Derived | From the N terminus of RNase 7 | Mycobacterium vaccae | Mycobacterium vaccae strain (ATCC 15483) | MIC = 20.0 ± 0.8 μM | In vitro | None | NA | NA | None | NA | NA | Membrane depolarization and permeabilization | Cell envelope | None | Antibacterial and Antiparasitic | 2013 | 23716047 |
| antitb_1263 | RN7 (1-45) | KPKGMTSSQWFKIQHMQPSPQASNSAMKNINKHTKRSKDLNTFLH | Free | Free | None | Linear | 45 | L | Cationic | Protein Derived | From the N terminus of RNase 8 | Mycobacterium vaccae | Mycobacterium vaccae strain (ATCC 15483) | IC50 = 9.5 ± 0.3 μM | In vitro | None | NA | NA | None | NA | NA | Membrane depolarization and permeabilization | Cell envelope | None | Antibacterial and Antiparasitic | 2013 | 23716047 |
| antitb_1266 | F91 | SEFAYGSFVRTVSLPVGADE | Free | Free | None | Linear | 20 | L | NA | Protein Derived | From 16kDa antigen | None | None | NA | In vivo | NA | NA | NA | Female BALB/c mice (6-8 wk, 20±2 g) | 20 nmol | It promotes the maturation of MHC-II and elicit secretion of IFN-Υ and also induce the expression of CD80, CD86 and CD40 co-stimulatory molecules and activate DCs to produce IL-6 and IL-12. | NA | NA | None | NA | 2013 | 24434326 |
| antitb_1267 | L91 | SEFAYGSFVRTVSLPVGADE | Free | Free | Conjugated to TLR2-ligand Pam2Cys | Linear | 20 | L | NA | Protein Derived | From 16kDa antigen | None | None | NA | In vivo | NA | NA | NA | Female BALB/c mice (6-8 wk, 20±2 g) | 20 nmol | It promotes the maturation of MHC-II and elicit secretion of IFN-Υ and also induce the expression of CD80, CD86 and CD40 co-stimulatory molecules and activate DCs to produce IL-6 and IL-12. | NA | NA | None | NA | 2013 | 24434326 |
| antitb_1268 | VapB30 (52-59) | ELAAIRHR | Free | Free | None | Linear | 8 | L | NA | Protein Derived | From VapB30 toxin | Mycobacterium tuberculosis | Mycobacterium tuberculosis (strain H37Rv) | NA | NA | NA | NA | NA | None | NA | NA | By disrupting the toxin-antitoxin complex (VapBC) | VapBC | None | NA | 2015 | 26150422 |
| antitb_1269 | VapC30 (14-30) | DEPDAERFEAAVEADHI | Free | Free | None | Linear | 17 | L | NA | Protein Derived | From VapC30 toxin | Mycobacterium tuberculosis | Mycobacterium tuberculosis (strain H37Rv) | NA | NA | NA | NA | NA | None | NA | NA | By disrupting the toxin-antitoxin complex (VapBC) | VapBC | None | NA | 2015 | 26150422 |
| antitb_1270 | VapC30 (48-56) | RFGEPGGRE | Free | Free | None | Linear | 9 | L | NA | Protein Derived | From VapC30 toxin | Mycobacterium tuberculosis | Mycobacterium tuberculosis (strain H37Rv) | NA | NA | NA | NA | NA | None | NA | NA | By disrupting the toxin-antitoxin complex (VapBC) | VapBC | None | NA | 2015 | 26150422 |
| antitb_1271 | Inhibitor 1 | PK-(boroMet) | Acetylation | Free | boroMet = methionine boronic acid | Linear | 3 | L | NA | Synthetic | substrate-based boronate inhibitors | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC50 = 12 μM | In vitro | Myeloma cells (MM1.S) | NA | No cytotoxicty | None | NA | NA | Inhibit ClpP1P2 peptidase activity and protein degradation in the presence of ClpC1 and ClpX ATPases. | ClpP1P2 peptidase | None | None | 2015 | 25759383 |
| antitb_1272 | Inhibitor 2 | HK-(boroMet) | Acetylation | Free | boroMet = methionine boronic acid | Linear | 3 | L | NA | Synthetic | substrate-based boronate inhibitors | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC50 = 6 μM | In vitro | Myeloma cells (MM1.S) | NA | No cytotoxicty | None | NA | NA | Inhibit ClpP1P2 peptidase activity and protein degradation in the presence of ClpC1 and ClpX ATPases. | ClpP1P2 peptidase | None | None | 2015 | 25759383 |
| antitb_1273 | Inhibitor 3 | AK-(boroMet) | Acetylation | Free | boroMet = methionine boronic acid | Linear | 3 | L | NA | Synthetic | substrate-based boronate inhibitors | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC50 = 3 μM | In vitro | Myeloma cells (MM1.S) | NA | No cytotoxicty | None | NA | NA | Inhibit ClpP1P2 peptidase activity and protein degradation in the presence of ClpC1 and ClpX ATPases. | ClpP1P2 peptidase | None | None | 2015 | 25759383 |
| antitb_1274 | Inhibitor 4 | Ala(1-naphtyl)-K-boroLeu | Free | Free | Ala(1-naphtyl) = 1-napthylalanine, boroLeu = leucine boronic acid | Linear | 3 | L | NA | Synthetic | substrate-based boronate inhibitors | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC50 = 12 μM | In vitro | Myeloma cells (MM1.S) | NA | No cytotoxicty | None | NA | NA | Inhibit ClpP1P2 peptidase activity and protein degradation in the presence of ClpC1 and ClpX ATPases. | ClpP1P2 peptidase | None | None | 2015 | 25759383 |
| antitb_1275 | Inhibitor 4 | Ala(1-naphtyl)-K-boroLeu | Free | Free | Ala(1-naphtyl) = 1-napthylalanine, boroLeu = leucine boronic acid | Linear | 3 | L | NA | Synthetic | substrate-based boronate inhibitors | Mycobacterium smegmatis | Mycobacterium smegmatis strain constitutively expressing GFP-ssrA | MIC50 = 1.5 μM | In vitro | Myeloma cells (MM1.S) | NA | No cytotoxicty | None | NA | NA | Inhibit ClpP1P2 peptidase activity and protein degradation in the presence of ClpC1 and ClpX ATPases. | ClpP1P2 peptidase | None | None | 2015 | 25759383 |
| antitb_1276 | Inhibitor 5 | WK-(boroMet) | Addition of N-picolinoyl | Free | boroLeu = leucine boronic acid | Linear | 3 | L | NA | Synthetic | substrate-based boronate inhibitors | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC50 = 3 μM | In vitro | Myeloma cells (MM1.S) | NA | Slight toxic (25%) at 10 μM | None | NA | NA | Inhibit ClpP1P2 peptidase activity and protein degradation in the presence of ClpC1 and ClpX ATPases. | ClpP1P2 peptidase | None | None | 2015 | 25759383 |
| antitb_1277 | Inhibitor 6 | AK-(boroMet) | Addition of N-picolinoyl | Free | boroMet = methionine boronic acid | Linear | 3 | L | NA | Synthetic | substrate-based boronate inhibitors | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC50 = 3 μM | In vitro | Myeloma cells (MM1.S) | NA | No cytotoxicty | None | NA | NA | Inhibit ClpP1P2 peptidase activity and protein degradation in the presence of ClpC1 and ClpX ATPases. | ClpP1P2 peptidase | None | None | 2015 | 25759383 |
| antitb_1278 | Inhibitor 7 | PK-(boroMet) | Addition of N-picolinoyl | Free | boroMet = methionine boronic acid | Linear | 3 | L | NA | Synthetic | substrate-based boronate inhibitors | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC50 = 24 μM | In vitro | Myeloma cells (MM1.S) | NA | No cytotoxicty | None | NA | NA | Inhibit ClpP1P2 peptidase activity and protein degradation in the presence of ClpC1 and ClpX ATPases. | ClpP1P2 peptidase | None | None | 2015 | 25759383 |
| antitb_1279 | Inhibitor 8 | K-(boroMet) | Addition of N-picolinoyl | Free | boroMet = methionine boronic acid | Linear | 2 | L | NA | Synthetic | substrate-based boronate inhibitors | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC50 = 6 μM | In vitro | Myeloma cells (MM1.S) | NA | No cytotoxicty | None | NA | NA | Inhibit ClpP1P2 peptidase activity and protein degradation in the presence of ClpC1 and ClpX ATPases. | ClpP1P2 peptidase | None | None | 2015 | 25759383 |
| antitb_1280 | Inhibitor 9 | K-(boroMet) | Addition of N-(3-Phenyl)propanoyl) | Free | boroMet = methionine boronic acid | Linear | 2 | L | NA | Synthetic | substrate-based boronate inhibitors | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC50 = 3 μM | In vitro | Myeloma cells (MM1.S) | NA | No cytotoxicty | None | NA | NA | Inhibit ClpP1P2 peptidase activity and protein degradation in the presence of ClpC1 and ClpX ATPases. | ClpP1P2 peptidase | None | None | 2015 | 25759383 |
| antitb_1281 | Inhibitor 10 | K-(boroMet) | Addition of N-(Benzyl) | Free | boroMet = methionine boronic acid | Linear | 2 | L | NA | Synthetic | substrate-based boronate inhibitors | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC50 = 6 μM | In vitro | Myeloma cells (MM1.S) | NA | No cytotoxicty | None | NA | NA | Inhibit ClpP1P2 peptidase activity and protein degradation in the presence of ClpC1 and ClpX ATPases. | ClpP1P2 peptidase | None | None | 2015 | 25759383 |
| antitb_1282 | Inhibitor 11 | K-(boroMet) | Addition of N-(2-(3,5-Difluorophenyl)acetyl) | Free | boroMet = methionine boronic acid | Linear | 2 | L | NA | Synthetic | substrate-based boronate inhibitors | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC50 = 6 μM | In vitro | Myeloma cells (MM1.S) | NA | No cytotoxicty | None | NA | NA | Inhibit ClpP1P2 peptidase activity and protein degradation in the presence of ClpC1 and ClpX ATPases. | ClpP1P2 peptidase | None | None | 2015 | 25759383 |
| antitb_1283 | Inhibitor 12 | W-(boroMet) | Addition of N-(2-(3,5-Difluorophenyl)acetyl) | Free | boroMet = methionine boronic acid | Linear | 2 | L | NA | Synthetic | substrate-based boronate inhibitors | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC50 = 12 μM | In vitro | Myeloma cells (MM1.S) | NA | No cytotoxicty | None | NA | NA | Inhibit ClpP1P2 peptidase activity and protein degradation in the presence of ClpC1 and ClpX ATPases. | ClpP1P2 peptidase | None | None | 2015 | 25759383 |
| antitb_1284 | Inhibitor 12 | W-(boroMet) | Addition of N-(2-(3,5-Difluorophenyl)acetyl) | Free | boroMet = methionine boronic acid | Linear | 2 | L | NA | Synthetic | substrate-based boronate inhibitors | Mycobacterium smegmatis | Mycobacterium smegmatis strain constitutively expressing GFP-ssrA | MIC50 = 12 μM | In vitro | Myeloma cells (MM1.S) | NA | No cytotoxicty | None | NA | NA | Inhibit ClpP1P2 peptidase activity and protein degradation in the presence of ClpC1 and ClpX ATPases. | ClpP1P2 peptidase | None | None | 2015 | 25759383 |
| antitb_1285 | Inhibitor 13 | K-(boroMet) | Addition of N-(1H-benzo(b)thiophene-7-carbonyl | Free | boroMet = methionine boronic acid | Linear | 2 | L | NA | Synthetic | substrate-based boronate inhibitors | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC50 = 12 μM | In vitro | Myeloma cells (MM1.S) | NA | No cytotoxicty | None | NA | NA | Inhibit ClpP1P2 peptidase activity and protein degradation in the presence of ClpC1 and ClpX ATPases. | ClpP1P2 peptidase | None | None | 2015 | 25759383 |
| antitb_1286 | Inhibitor 14 | K-(boroMet) | Addition of N-(Phenylmetanesulfonyl) | Free | boroMet = methionine boronic acid | Linear | 2 | L | NA | Synthetic | substrate-based boronate inhibitors | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC50 = 200 μM | In vitro | Myeloma cells (MM1.S) | NA | No cytotoxicty | None | NA | NA | Inhibit ClpP1P2 peptidase activity and protein degradation in the presence of ClpC1 and ClpX ATPases. | ClpP1P2 peptidase | None | None | 2015 | 25759383 |
| antitb_1287 | Bcn1Â | FVYGNGVTSILVQAQFLVNGQRRFFYTPDK | Free | Free | None | Linear | 30 | L | NA | Natural | Isolated from diverse Gram-positive bacteria species | Mycobacterium tuberculosis | Mycobacterium tuberculosis strain H37Rv | MIC90 = 0.1 mg/L | Both | Mouse macrophages | No inhibition | No cytotoxicty | None | NA | NA | Formation of pores in cell membranes | Cell envelope | None | None | 2007 | 17347179 |
| antitb_1288 | Bcn2 | ATYYGNGLYCNKQKHYTWVDWNKASREIGKITVNGWVQH | Free | Free | None | Linear | 39 | L | NA | Natural | Isolated from diverse Gram-positive bacteria species | Mycobacterium tuberculosis | Mycobacterium tuberculosis strain H37Rv | MIC90 = 0.1 mg/L | Both | Mouse macrophages | No inhibition | Negligible at a concentration of 1 mg/L | None | NA | NA | Formation of pores in cell membranes | Cell envelope | None | None | 2007 | 17347179 |
| antitb_1289 | Bcn3 | KTYYGTNGVHCTKNSLWGKVRLKNMKYDQNTTYMGRLQDILLGWATGAFGKTH | Free | Free | None | Linear | 53 | L | NA | Natural | Isolated from diverse Gram-positive bacteria species | Mycobacterium tuberculosis | Mycobacterium tuberculosis strain H37Rv | MIC90 = 0.1 mg/L | Both | Mouse macrophages | No inhibition | Negligible at a concentration of 1 mg/L | None | NA | NA | Formation of pores in cell membranes | Cell envelope | None | None | 2007 | 17347179 |
| antitb_1290 | Bcn4 | RWYYGNGVGGVGGAAVCGLAGYVGEAKENIAGEVRKGWGMAGGFTHNKACKSFPGSGWASG | Free | Free | None | Linear | 61 | L | NA | Natural | Isolated from diverse Gram-positive bacteria species | Mycobacterium tuberculosis | Mycobacterium tuberculosis strain H37Rv | MIC90 = 0.1 mg/L | Both | Mouse macrophages | No inhibition | No cytotoxicty | None | NA | NA | Formation of pores in cell membranes | Cell envelope | None | None | 2007 | 17347179 |