Primary information |
---|
ID | antitb_1289, |
Name | 17347179 |
N-Terminal modification | Bcn3 |
C-Terminal Modification | KTYYGTNGVHCTKNSLWGKVRLKNMKYDQNTTYMGRLQDILLGWATGAFGKTH |
Chemical Modification | Free |
Linear/Cyclic | Free |
Length | None |
Chirality | Linear |
Nature | 53 |
Source | L |
Species | Natural |
Strain | Isolated from diverse Gram-positive bacteria species |
Inhibition Concentration | Mycobacterium tuberculosis |
In Vitro/ In vivo | Mycobacterium tuberculosis strain H37Rv |
Cell Line | MIC90 = 0.1 mg/L |
Inhibition Concentration | Both |
Sequence | 2007 |
Cytotoxicity | Mouse macrophages |
In vivo Model | No inhibition |
Lethal Dose | Negligible at a concentration of 1 mg/L |
Immune Responce | None |
Mechanism of Action | NA |
Target | NA |
Combination Therapy | Formation of pores in cell membranes |
Other activities | Cell envelope |
PMID | None |
Year of Publication | None |
Tertiary Structure (Technique) | Not Predicted), |