| Primary information |
|---|
| ID | antitb_1289, |
| Name | 17347179 |
| N-Terminal modification | Bcn3 |
| C-Terminal Modification | KTYYGTNGVHCTKNSLWGKVRLKNMKYDQNTTYMGRLQDILLGWATGAFGKTH |
| Chemical Modification | Free |
| Linear/Cyclic | Free |
| Length | None |
| Chirality | Linear |
| Nature | 53 |
| Source | L |
| Species | Natural |
| Strain | Isolated from diverse Gram-positive bacteria species |
| Inhibition Concentration | Mycobacterium tuberculosis |
| In Vitro/ In vivo | Mycobacterium tuberculosis strain H37Rv |
| Cell Line | MIC90 = 0.1 mg/L |
| Inhibition Concentration | Both |
| Sequence | 2007 |
| Cytotoxicity | Mouse macrophages |
| In vivo Model | No inhibition |
| Lethal Dose | Negligible at a concentration of 1 mg/L |
| Immune Responce | None |
| Mechanism of Action | NA |
| Target | NA |
| Combination Therapy | Formation of pores in cell membranes |
| Other activities | Cell envelope |
| PMID | None |
| Year of Publication | None |
Tertiary Structure
(Technique) | Not Predicted), |