Please click on the ID to see detailed information about each entry.
The total number entries retrieved from this search are| ID1194 | SequenceMpr-YFQNCPrG | NameDesmopressin | Nature of peptide or cargoIt is a peptide hormone that is used chiefly for treatment of enuresis | AssayRadioimmunoassay | Tissue permeability10 ng/ml serum conc. of desmopressin after ~100 min of coated microneedle array application | Tissue SampleLateral skin areas of the thorax of hairless guinea pigs | PUBMED ID15212882 |
| ID1195 | SequenceMpr-YFQNCPrG | NameDesmopressin | Nature of peptide or cargoIt is a peptide hormone that is used chiefly for treatment of enuresis | AssayRadioimmunoassay | Tissue permeability1 ng/ml serum conc. of desmopressin after ~250 min of coated microneedle array application | Tissue SampleLateral skin areas of the thorax of hairless guinea pigs | PUBMED ID15212882 |
| ID1196 | SequenceMpr-YFQNCPrG | NameDesmopressin | Nature of peptide or cargoIt is a peptide hormone that is used chiefly for treatment of enuresis | AssayRadioimmunoassay | Tissue permeability0.8 ng/ml serum conc. of desmopressin after ~350 min of coated microneedle array application | Tissue SampleLateral skin areas of the thorax of hairless guinea pigs | PUBMED ID15212882 |
| ID1197 | SequenceSIINFEKL | NameOVA8 | Nature of peptide or cargoOVA8 peptides can be used to detect a strong CD8+ cytolytic T cell response | AssayHistochemical staining | Tissue permeabilityDistributed uniformly on the skin surface without obvious penetration into deeper layers of the epidermis or the dermis. | Tissue SampleTape-stripped ears of mice | PUBMED ID15121311 |
| ID1198 | SequenceRQIKIWFQNRRMKWK KSIINFEKL | NameANTP-OVA8 (OVA257–264 linked to Antennapedia transduction sequence) | Nature of peptide or cargoANTP-OVA8 enhances the delivery of the antigen through the skin and promotes the generation of CTL | AssayHistochemical staining | Tissue permeabilityPenetration of the antigen across skin surface with strong staining of all skin tissue layers. The penetration was rapid and detectable at 30 min | Tissue SampleTape-stripped ears of mice | PUBMED ID15121311 |
| ID1199 | SequencepGlu-HWSYGLRPG | NameLHRH | Nature of peptide or cargoPeptides containing closely juxtapositioned cationic and lipohilic residues are able to inhibit their own transport across the skin even under the influence of iontophoretic current. | AssayHPLC | Tissue permeabilityLHRH flux= 2.37 ± 0.94 µg h−1 cm−2 at 100% DC | Tissue SampleHuman cadaver skin | PUBMED ID14757511 |
| ID1200 | SequencepGlu-HWSYGLRPG | NameLHRH | Nature of peptide or cargoPeptides containing closely juxtapositioned cationic and lipohilic residues are able to inhibit their own transport across the skin even under the influence of iontophoretic current. | AssayHPLC | Tissue permeabilityLHRH flux= 9.87 ± 4.91 µg h−1 cm−2 at 75% pulsed DC | Tissue SampleHuman cadaver skin | PUBMED ID14757511 |
| ID1201 | SequencepGlu-HWSYGLRPG | NameLHRH | Nature of peptide or cargoPeptides containing closely juxtapositioned cationic and lipohilic residues are able to inhibit their own transport across the skin even under the influence of iontophoretic current. | AssayHPLC | Tissue permeabilityLHRH flux= 5.57 ± 2.27 µg h−1 cm−2 at 50% pulsed DC | Tissue SampleHuman cadaver skin | PUBMED ID14757511 |
| ID1202 | SequencepGlu-HWSYGLRPG | NameLHRH | Nature of peptide or cargoPeptides containing closely juxtapositioned cationic and lipohilic residues are able to inhibit their own transport across the skin even under the influence of iontophoretic current. | AssayHPLC | Tissue permeabilityLHRH flux= 1.21 ± 0.76 µg h−1 cm−2 at 75%+/25%− AC | Tissue SampleHuman cadaver skin | PUBMED ID14757511 |
| ID1203 | SequencepGlu-HWSYGLRPG | NameLHRH | Nature of peptide or cargoPeptides containing closely juxtapositioned cationic and lipohilic residues are able to inhibit their own transport across the skin even under the influence of iontophoretic current. | AssayHPLC | Tissue permeabilityLHRH flux= 0.006 ± 0.004 µg h−1 cm−2 at 50%+/50%− AC | Tissue SampleHuman cadaver skin | PUBMED ID14757511 |
| ID1204 | SequencepGlu-HWSY-D-2-Nal-LRPG | NameNafarelin | Nature of peptide or cargoPeptides containing closely juxtapositioned cationic and lipohilic residues are able to inhibit their own transport across the skin even under the influence of iontophoretic current. | AssayHPLC | Tissue permeabilityNafarelin flux= 1.99 ± 2.04 µg h−1 cm−2 at 100% DC | Tissue SampleHuman cadaver skin | PUBMED ID14757511 |
| ID1205 | SequencepGlu-HWSY-D-2-Nal-LRPG | NameNafarelin | Nature of peptide or cargoPeptides containing closely juxtapositioned cationic and lipohilic residues are able to inhibit their own transport across the skin even under the influence of iontophoretic current. | AssayHPLC | Tissue permeabilityNafarelin flux= 6.47 ± 0.87 µg h−1 cm−2 at 75% DC | Tissue SampleHuman cadaver skin | PUBMED ID14757511 |
| ID1206 | SequencepGlu-HWSY-D-2-Nal-LRPG | NameNafarelin | Nature of peptide or cargoPeptides containing closely juxtapositioned cationic and lipohilic residues are able to inhibit their own transport across the skin even under the influence of iontophoretic current. | AssayHPLC | Tissue permeabilityNafarelin flux= 0.96 ± 0.79 µg h−1 cm−2 at 50% pulsed DC | Tissue SampleHuman cadaver skin | PUBMED ID14757511 |
| ID1207 | SequencepGlu-HWSY-D-2-Nal-LRPG | NameNafarelin | Nature of peptide or cargoPeptides containing closely juxtapositioned cationic and lipohilic residues are able to inhibit their own transport across the skin even under the influence of iontophoretic current. | AssayHPLC | Tissue permeabilityNafarelin flux= 3.33 ± 1.04 µg h−1 cm−2 at 75%+/25%- AC | Tissue SampleHuman cadaver skin | PUBMED ID14757511 |
| ID1208 | SequencepGlu-HWSY-D-2-Nal-LRPG | NameNafarelin | Nature of peptide or cargoPeptides containing closely juxtapositioned cationic and lipohilic residues are able to inhibit their own transport across the skin even under the influence of iontophoretic current. | AssayHPLC | Tissue permeabilityNafarelin flux= 0.15 ± 0.09 µg h−1 cm−2 at 50%+/50%- AC | Tissue SampleHuman cadaver skin | PUBMED ID14757511 |
| ID1209 | SequencepGlu-HWSYGLRPG | NameLHRH | Nature of peptide or cargoPeptides containing closely juxtapositioned cationic and lipohilic residues are able to inhibit their own transport across the skin even under the influence of iontophoretic current. | AssayHPLC | Tissue permeabilityLHRH flux= 12.39 ± 5.32 µg h−1 cm−2 at 75% pulsed DC (500 Hz) | Tissue SampleEpidermis of human cadaver skin | PUBMED ID14757511 |
| ID1210 | SequencepGlu-HWSYGLRPG | NameLHRH | Nature of peptide or cargoPeptides containing closely juxtapositioned cationic and lipohilic residues are able to inhibit their own transport across the skin even under the influence of iontophoretic current. | AssayHPLC | Tissue permeabilityLHRH flux= 5.97 ± 3.20 µg h−1 cm−2 at 50% pulsed DC (500 Hz) | Tissue SampleEpidermis of human cadaver skin | PUBMED ID14757511 |
| ID1211 | SequencepGlu-HWSYGLRPG | NameLHRH | Nature of peptide or cargoPeptides containing closely juxtapositioned cationic and lipohilic residues are able to inhibit their own transport across the skin even under the influence of iontophoretic current. | AssayHPLC | Tissue permeabilityLHRH flux=9.07 ± 4.28 µg h−1 cm−2 at 25% pulsed DC (500 Hz) | Tissue SampleEpidermis of human cadaver skin | PUBMED ID14757511 |
| ID1212 | SequencepGlu-HWSYGLRPG | NameLHRH | Nature of peptide or cargoPeptides containing closely juxtapositioned cationic and lipohilic residues are able to inhibit their own transport across the skin even under the influence of iontophoretic current. | AssayHPLC | Tissue permeabilityLHRH flux= 8.70±3.56 µg h−1 cm−2 at 75% pulsed DC (5 Hz) | Tissue SampleEpidermis of human cadaver skin | PUBMED ID14757511 |
| ID1213 | SequencepGlu-HWSYGLRPG | NameLHRH | Nature of peptide or cargoPeptides containing closely juxtapositioned cationic and lipohilic residues are able to inhibit their own transport across the skin even under the influence of iontophoretic current. | AssayHPLC | Tissue permeabilityLHRH flux= 7.31±1.94 µg h−1 cm−2 at 50% pulsed DC (5 Hz) | Tissue SampleEpidermis of human cadaver skin | PUBMED ID14757511 |
| ID1214 | SequencepGlu-HWSYGLRPG | NameLHRH | Nature of peptide or cargoPeptides containing closely juxtapositioned cationic and lipohilic residues are able to inhibit their own transport across the skin even under the influence of iontophoretic current. | AssayHPLC | Tissue permeabilityLHRH flux= 9.35±1.98 µg h−1 cm−2 at 25% pulsed DC (5 Hz) | Tissue SampleEpidermis of human cadaver skin | PUBMED ID14757511 |
| ID1215 | SequenceSVSEIQLMHNLGKHL NSMERVEWLRKKLQD VHNF | NameParathyroid Hormone (PTH) | Nature of peptide or cargoPTH is an important regulator of calcium and phosphorus metabolism and used for treatment of psoriasis. | AssayFranz cell | Tissue permeability<1% PTH dissolved in normal saline recovered in the lower chamber of the Franz cell after 24 h | Tissue SampleSurgically obtained adult abdominal human epidermis | PUBMED ID12932245 |
| ID1216 | SequenceSVSEIQLMHNLGKHL NSMERVEWLRKKLQD VHNF | NameParathyroid Hormone (PTH) | Nature of peptide or cargoPTH is an important regulator of calcium and phosphorus metabolism and used for treatment of psoriasis. | AssayFranz cell | Tissue permeability<1% PTH dissolved in propylene glycol recovered in the lower chamber of the Franz cell after 24 h | Tissue SampleSurgically obtained adult abdominal human epidermis | PUBMED ID12932245 |
| ID1217 | SequenceSVSEIQLMHNLGKHL NSMERVEWLRKKLQD VHNF | NameParathyroid Hormone (PTH) | Nature of peptide or cargoPTH is an important regulator of calcium and phosphorus metabolism and used for treatment of psoriasis. | AssayFranz cell | Tissue permeability45% PTH formulated in Novasome A cream recovered in the lower chamber of the Franz cell after 24 h | Tissue SampleSurgically obtained adult abdominal human epidermis | PUBMED ID12932245 |
| ID1218 | SequenceI/V-CLe-I/V-K-orn-I/V-fHdN | NameBacitracin | Nature of peptide or cargoBactericidal antibiotic often used topically. It is a cyclic peptide that contains positively and negatively charged lateral chains at neutral pH and is composed of a mixture of L and D amino acids. | AssayFluorescein-labeled bacitracin and confocal microscopy, HPLC | Tissue permeabilityBacitracin Cumulative Amount(µg/cm2)=42.3±3.8 | Tissue SampleHuman epidermis from abdominal sites of Caucasian females | PUBMED ID12712421 |
| ID1219 | SequenceI/V-CLe-I/V-K-orn-I/V-fHdN | NameBacitracin | Nature of peptide or cargoBactericidal antibiotic often used topically. It is a cyclic peptide that contains positively and negatively charged lateral chains at neutral pH and is composed of a mixture of L and D amino acids. | AssayFluorescein-labeled bacitracin and confocal microscopy, HPLC | Tissue permeabilityBacitracin Cumulative Amount(µg/cm2)=80.2±4.7 | Tissue SampleHuman epidermis from abdominal sites of Caucasian females | PUBMED ID12712421 |
| ID1220 | SequenceI/V-CLe-I/V-K-orn-I/V-fHdN | NameBacitracin | Nature of peptide or cargoBactericidal antibiotic often used topically. It is a cyclic peptide that contains positively and negatively charged lateral chains at neutral pH and is composed of a mixture of L and D amino acids. | AssayFluorescein-labeled bacitracin and confocal microscopy, HPLC | Tissue permeabilityBacitracin Cumulative Amount(µg/cm2)=44.1±4 | Tissue SampleHuman epidermis from abdominal sites of Caucasian females | PUBMED ID12712421 |
| ID1221 | SequenceI/V-CLe-I/V-K-orn-I/V-fHdN | NameBacitracin | Nature of peptide or cargoBactericidal antibiotic often used topically. It is a cyclic peptide that contains positively and negatively charged lateral chains at neutral pH and is composed of a mixture of L and D amino acids. | AssayFluorescein-labeled bacitracin and confocal microscopy, HPLC | Tissue permeabilityBacitracin Cumulative Amount(µg/cm2)=82.1±4.4 | Tissue SampleHuman epidermis from abdominal sites of Caucasian females | PUBMED ID12712421 |
| ID1222 | SequenceI/V-CLe-I/V-K-orn-I/V-fHdN | NameBacitracin | Nature of peptide or cargoBactericidal antibiotic often used topically. It is a cyclic peptide that contains positively and negatively charged lateral chains at neutral pH and is composed of a mixture of L and D amino acids. | AssayFluorescein-labeled bacitracin and confocal microscopy, HPLC | Tissue permeabilityBacitracin Cumulative Amount(µg/cm2)=52.8±4.4 | Tissue SampleHuman epidermis from abdominal sites of Caucasian females | PUBMED ID12712421 |
| ID1223 | SequenceI/V-CLe-I/V-K-orn-I/V-fHdN | NameBacitracin | Nature of peptide or cargoBactericidal antibiotic often used topically. It is a cyclic peptide that contains positively and negatively charged lateral chains at neutral pH and is composed of a mixture of L and D amino acids. | AssayFluorescein-labeled bacitracin and confocal microscopy, HPLC | Tissue permeabilityBacitracin Cumulative Amount(µg/cm2)=95±2.9 | Tissue SampleHuman epidermis from abdominal sites of Caucasian females | PUBMED ID12712421 |
| ID1224 | Sequence(Chain A: GIVEQCCTSICSLYQLENYCN) (Chain B: FVNQHLCGSHLVEALYLVCGERGFFYTPKT) | NameInsulin in poloxamer gel 407 | Nature of peptide or cargoIt is used in the treatment diabetes mellitus and has immense therapeutic and commercial importance | AssayFranz diffusion cells, Radioimuunoassay | Tissue permeabilitySkin permeation parameters of insulin from poloxamer 407 gel using menthone enhancer, Lag time (h)=1.20 (0.02) , Flux (µg/cm2 /h)=5.57 (0.13), Cumulative amount permeated (µg)=210.78 (2.64), Skin affinity=10.57 (0.38), (P<0.05), all values are n=3 | Tissue SampleFemale Sprague–Dawley rat skin | PUBMED ID12695068 |
| ID1225 | Sequence(Chain A: GIVEQCCTSICSLYQLENYCN) (Chain B: FVNQHLCGSHLVEALYLVCGERGFFYTPKT) | NameInsulin in poloxamer gel 408 | Nature of peptide or cargoIt is used in the treatment diabetes mellitus and has immense therapeutic and commercial importance | AssayFranz diffusion cells, Radioimuunoassay | Tissue permeabilitySkin permeation parameters of insulin from poloxamer 407 gel using linoleic acid enhancer, Lag time (h)=0.65 (0.49) , Flux (µg/cm2 /h)=8.08 (0.20), Cumulative amount permeated (µg)=244.38 (30.21), Skin affinity=5.28 (2.37), (P<0.05), all values are n=3 | Tissue SampleFemale Sprague–Dawley rat skin | PUBMED ID12695068 |
| ID1226 | SequenceCSNLSTCVLGKLSQEL HKLQTYPRTNTGSGTP | NameSalmon calcitonin (sCT) | Nature of peptide or cargoA peptide hormone which inhibits bone resorption by inhibiting the activity of osteoclasts. | AssayRadioimmunoassay | Tissue permeabilityArea Under the Curve0–120 min (ng·min/ml)=19.8±2.9 , Absolute Bioavailability (%)=33.2 , Relative Bioavailability (%)=68.6 | Tissue SampleStratum corneum of the stomach of SD male rats | PUBMED ID11337153 |
| ID1227 | SequenceCSNLSTCVLGKLSQEL HKLQTYPRTNTGSGTP | NameSalmon calcitonin (sCT) | Nature of peptide or cargoA peptide hormone which inhibits bone resorption by inhibiting the activity of osteoclasts. | AssayRadioimmunoassay | Tissue permeabilityArea Under the Curve0–120 min (ng·min/ml)=43.0±5.0 , Absolute Bioavailability (%)=37.0 , Relative Bioavailability (%)=76.5 | Tissue SampleStratum corneum of the stomach of SD male rats | PUBMED ID11337153 |
| ID1228 | SequenceCSNLSTCVLGKLSQEL HKLQTYPRTNTGSGTP | NameSalmon calcitonin (sCT) | Nature of peptide or cargoA peptide hormone which inhibits bone resorption by inhibiting the activity of osteoclasts. | AssayRadioimmunoassay | Tissue permeabilityArea Under the Curve0–120 min (ng·min/ml)=72.2±7.3 , Absolute Bioavailability (%)=32.5 , Relative Bioavailability (%)=67.2 | Tissue SampleStratum corneum of the stomach of SD male rats | PUBMED ID11337153 |
| ID1229 | SequencepGlu-HP | NameThyrotropin-releasing hormone (TRH) | Nature of peptide or cargoTRH has potential clinical value in the treatment of neurotrauma and various neurologic and psychiatric disorders besides its well known endocrinological effects | AssayCardiovascular parameters and blood gas values determined by collecting blood at different time intervals | Tissue permeabilityOn application of TRH, cardiovascular parameters and blood gas values:Mean arterial blood pressure(kPa)-11.1 ± 0.7, Basal skin blood flow(PU)-378 ± 47, Heart rate(min-1)-424 ± 26, Respiratory rate(min-1)-113 ± 8, pH-7.38 ± 0.02, pCO2(kPa)-7.07 ± 0.37 and pO2(kPa)-7.91 ± 0.25 | Tissue SampleStratum corneum of the abdominal area of male Sprague-Dawley rats | PUBMED ID11179600 |
| ID1230 | SequencepGlu-HP | NameThyrotropin-releasing hormone (TRH) | Nature of peptide or cargoTRH has potential clinical value in the treatment of neurotrauma and various neurologic and psychiatric disorders besides its well known endocrinological effects | AssayCardiovascular parameters and blood gas values determined by collecting blood at different time intervals | Tissue permeabilityOn application of TRH, cardiovascular parameters and blood gas values:Mean arterial blood pressure(kPa)-10.8 ± 1.0, Basal skin blood flow(PU)-421 ± 4, Heart rate(min-1)-417 ± 23, Respiratory rate(min-1)-118 ± 6, pH-7.39 ± 0.01, pCO2(kPa)-6.82 ± 0.27 and pO2(kPa)-8.43 ± 0.24 | Tissue SampleStratum corneum of the abdominal area of male Sprague-Dawley rats | PUBMED ID11179600 |
| ID1231 | SequencepGlu-HP | NameThyrotropin-releasing hormone (TRH) | Nature of peptide or cargoTRH has potential clinical value in the treatment of neurotrauma and various neurologic and psychiatric disorders besides its well known endocrinological effects | AssayCardiovascular parameters and blood gas values determined by collecting blood at different time intervals | Tissue permeabilityOn application of TRH, cardiovascular parameters and blood gas values:Mean arterial blood pressure(kPa)-10.5 ± 1.0, Basal skin blood flow(PU)-454 ± 23, Heart rate(min-1)-423 ± 23, Respiratory rate(min-1)-123 ± 6, pH-7.40 ± 0.02, pCO2(pKa)-6.46 ± 0.31 and pO2(pKa)-9.87 ± 1.49 | Tissue SampleStratum corneum of the abdominal area of male Sprague-Dawley rats | PUBMED ID11179600 |
| ID1232 | SequencepGlu-HP | NameThyrotropin-releasing hormone (TRH) | Nature of peptide or cargoTRH has potential clinical value in the treatment of neurotrauma and various neurologic and psychiatric disorders besides its well known endocrinological effects | AssayCardiovascular parameters and blood gas values determined by collecting blood at different time intervals | Tissue permeabilityOn application of TRH, cardiovascular parameters and blood gas values:Mean arterial blood pressure(kPa)-9.5 ± 0.8, Basal skin blood flow(PU)-348 ± 62, Heart rate(min-1)-419 ± 26, Respiratory rate(min-1)-115 ± 7, pH-7.37 ± 0.02, pCO2(pKa)-7.05 ± 0.56 and pO2(pKa)-7.39 ± 0.33 | Tissue SampleStratum corneum of the abdominal area of male Sprague-Dawley rats | PUBMED ID11179600 |
| ID1233 | SequencepGlu-HP | NameThyrotropin-releasing hormone (TRH) | Nature of peptide or cargoTRH has potential clinical value in the treatment of neurotrauma and various neurologic and psychiatric disorders besides its well known endocrinological effects | AssayCardiovascular parameters and blood gas values determined by collecting blood at different time intervals | Tissue permeabilityOn application of TRH, cardiovascular parameters and blood gas values:Mean arterial blood pressure(kPa)-11.3 ± 0.7, Basal skin blood flow(PU)-370 ± 55, Heart rate(min-1)-329 ± 12, Respiratory rate(min-1)-89 ± 5, pH-7.33 ± 0.01, pCO2(pKa)-8.31 ± 0.25 and pO2(pKa)-9.24 ± 1.03 | Tissue SampleStratum corneum of the abdominal area of male Sprague-Dawley rats | PUBMED ID11179600 |
| ID1234 | SequencepGlu-HP | NameThyrotropin-releasing hormone (TRH) | Nature of peptide or cargoTRH has potential clinical value in the treatment of neurotrauma and various neurologic and psychiatric disorders besides its well known endocrinological effects | AssayCardiovascular parameters and blood gas values determined by collecting blood at different time intervals | Tissue permeabilityOn application of TRH, cardiovascular parameters and blood gas values:Mean arterial blood pressure(kPa)-9.9 ± 0.8, Basal skin blood flow(PU)-358 ± 47, Heart rate(min-1)-349 ± 15, Respiratory rate(min-1)-101 ± 5, pH-7.33 ± 0.01, pCO2(pKa)-7.85 ± 0.23 and pO2(pKa)-9.30 ± 0.71 | Tissue SampleStratum corneum of the abdominal area of male Sprague-Dawley rats | PUBMED ID11179600 |
| ID1235 | SequencepGlu-HP | NameThyrotropin-releasing hormone (TRH) | Nature of peptide or cargoTRH has potential clinical value in the treatment of neurotrauma and various neurologic and psychiatric disorders besides its well known endocrinological effects | AssayCardiovascular parameters and blood gas values determined by collecting blood at different time intervals | Tissue permeabilityOn application of TRH, cardiovascular parameters and blood gas values:Mean arterial blood pressure(kPa)-9.0 ± 0.5, Basal skin blood flow(PU)-287 ± 51, Heart rate(min-1)-353 ± 14, Respiratory rate(min-1)-98 ± 4, pH-7.33 ± 0.01, pCO2(pKa)-7.72 ± 0.34 and pO2(pKa)-8.43 ± 0.63 | Tissue SampleStratum corneum of the abdominal area of male Sprague-Dawley rats | PUBMED ID11179600 |
| ID1236 | SequencepGlu-HP | NameThyrotropin-releasing hormone (TRH) | Nature of peptide or cargoTRH has potential clinical value in the treatment of neurotrauma and various neurologic and psychiatric disorders besides its well known endocrinological effects | AssayCardiovascular parameters and blood gas values determined by collecting blood at different time intervals | Tissue permeabilityOn application of TRH, cardiovascular parameters and blood gas values:Mean arterial blood pressure(kPa)-8.2 ± 0.4, Basal skin blood flow(PU)-244 ± 50, Heart rate(min-1)-359 ± 11, Respiratory rate(min-1)-91 ± 9, pH-7.35 ± 0.02, pCO2(pKa)-6.89 ± 0.33 and pO2(pKa)-10.8 ± 1.55 | Tissue SampleStratum corneum of the abdominal area of male Sprague-Dawley rats | PUBMED ID11179600 |
| ID1237 | SequencepGlu-3-methyl-HP | NameM-TRH | Nature of peptide or cargoTRH has potential clinical value in the treatment of neurotrauma and various neurologic and psychiatric disorders besides its well known endocrinological effects | AssayCardiovascular parameters and blood gas values determined by collecting blood at different time intervals | Tissue permeabilityOn application of M-TRH, cardiovascular parameters and blood gas values:Mean arterial blood pressure(kPa)-11.2 ± 0.2, Basal skin blood flow(PU)-380 ± 44, Heart rate(min-1)-387 ± 18, Respiratory rate(min-1)-105 ± 10, pH-7.36 ± 0.03, pCO2(pKa)-7.42 ± 0.49 and pO2(pKa)-8.32 ± 0.70 | Tissue SampleStratum corneum of the abdominal area of male Sprague-Dawley rats | PUBMED ID11179600 |
| ID1238 | SequencepGlu-3-methyl-HP | NameM-TRH | Nature of peptide or cargoTRH has potential clinical value in the treatment of neurotrauma and various neurologic and psychiatric disorders besides its well known endocrinological effects | AssayCardiovascular parameters and blood gas values determined by collecting blood at different time intervals | Tissue permeabilityOn application of M-TRH, cardiovascular parameters and blood gas values:Mean arterial blood pressure(kPa)-10.5 ± 0.5, Basal skin blood flow(PU)-305 ± 72, Heart rate(min-1)-385 ± 3, Respiratory rate(min-1)-113 ± 5, pH-7.39 ± 0.01, pCO2(pKa)-6.72 ± 0.08 and pO2(pKa)-7.99 ± 0.60 | Tissue SampleStratum corneum of the abdominal area of male Sprague-Dawley rats | PUBMED ID11179600 |
| ID1239 | SequencepGlu-3-methyl-HP | NameM-TRH | Nature of peptide or cargoTRH has potential clinical value in the treatment of neurotrauma and various neurologic and psychiatric disorders besides its well known endocrinological effects | AssayCardiovascular parameters and blood gas values determined by collecting blood at different time intervals | Tissue permeabilityOn application of M-TRH, cardiovascular parameters and blood gas values:Mean arterial blood pressure(kPa)-10.1 ± 0.5, Basal skin blood flow(PU)-259 ± 69, Heart rate(min-1)-378 ± 4, Respiratory rate(min-1)-110 ± 8, pH-7.41 ± 0.01, pCO2(pKa)-6.51 ± 0.04 and pO2(pKa)-8.44 ± 0.46 | Tissue SampleStratum corneum of the abdominal area of male Sprague-Dawley rats | PUBMED ID11179600 |
| ID1240 | SequencepGlu-3-methyl-HP | NameM-TRH | Nature of peptide or cargoTRH has potential clinical value in the treatment of neurotrauma and various neurologic and psychiatric disorders besides its well known endocrinological effects | AssayCardiovascular parameters and blood gas values determined by collecting blood at different time intervals | Tissue permeabilityOn application of M-TRH, cardiovascular parameters and blood gas values:Mean arterial blood pressure(kPa)-9.9 ± 0.8, Basal skin blood flow(PU)-202 ± 71, Heart rate(min-1)-372 ± 17, Respiratory rate(min-1)-101 ± 4, pH-7.40 ± 0.01, pCO2(pKa)-6.58 ± 0.20 and pO2(pKa)-8.73 ± 0.60 | Tissue SampleStratum corneum of the abdominal area of male Sprague-Dawley rats | PUBMED ID11179600 |
| ID1241 | SequencepGlu-3-methyl-HP | NameM-TRH | Nature of peptide or cargoTRH has potential clinical value in the treatment of neurotrauma and various neurologic and psychiatric disorders besides its well known endocrinological effects | AssayCardiovascular parameters and blood gas values determined by collecting blood at different time intervals | Tissue permeabilityOn application of M-TRH, cardiovascular parameters and blood gas values:Mean arterial blood pressure(kPa)-11.0 ± 0.31, Basal skin blood flow(PU)-382 ± 32, Heart rate(min-1)-400 ± 8, Respiratory rate(min-1)-116 ± 7, pH-7.35 ± 0.01, pCO2(pKa)-7.73 ± 0.24 and pO2(pKa)-9.59 ± 1.04 | Tissue SampleStratum corneum of the abdominal area of male Sprague-Dawley rats | PUBMED ID11179600 |
| ID1242 | SequencepGlu-3-methyl-HP | NameM-TRH | Nature of peptide or cargoTRH has potential clinical value in the treatment of neurotrauma and various neurologic and psychiatric disorders besides its well known endocrinological effects | AssayCardiovascular parameters and blood gas values determined by collecting blood at different time intervals | Tissue permeabilityOn application of M-TRH, cardiovascular parameters and blood gas values:Mean arterial blood pressure(kPa)-10.7 ± 0.31, Basal skin blood flow(PU)-294 ± 42, Heart rate(min-1)-404 ± 10, Respiratory rate(min-1)-116 ± 7, pH-7.36 ± 0.01, pCO2(pKa)-7.14 ± 0.22 and pO2(pKa)-8.57 ± 0.31 | Tissue SampleStratum corneum of the abdominal area of male Sprague-Dawley rats | PUBMED ID11179600 |
| ID1243 | SequencepGlu-3-methyl-HP | NameM-TRH | Nature of peptide or cargoTRH has potential clinical value in the treatment of neurotrauma and various neurologic and psychiatric disorders besides its well known endocrinological effects | AssayCardiovascular parameters and blood gas values determined by collecting blood at different time intervals | Tissue permeabilityOn application of M-TRH, cardiovascular parameters and blood gas values:Mean arterial blood pressure(kPa)-10.3 ± 0.33, Basal skin blood flow(PU)-213 ± 48, Heart rate(min-1)-407 ± 13, Respiratory rate(min-1)-107 ± 9, pH-7.38 ± 0.01, pCO2(pKa)-6.62 ± 0.24 and pO2(pKa)-10.6 ± 1.13 | Tissue SampleStratum corneum of the abdominal area of male Sprague-Dawley rats | PUBMED ID11179600 |