Browse result page of FermFooDB Database

This is the result page of browse. This page gives the information about peptides returned against the selected category. Further details of the peptide can be seen by clicking on the FMDB_ID. Further the user can sort the peptides on the basis of various fields by clicking on the respective headers.

The total number entries retrieved from this search are 92

FMDB_IDPubMed IDReferenceTitlePeptide_SequenceSequenceLength of peptideFood_Matrix Protein pHTemperatureIncubation TimeActivityExperimentModelAssay for Activity MeasurementCultureHydrolysisMethod of analysisM_Z ratioMassIC50
FMDB33716476172NANAWLAHKWLAHK5goat WheyAlpha lactoglobulinNANANAAce-inhibitoryIn vitroNANACan parapsilosis and Lb paracaseiproteaseNANA NANA
FMDB33821787916NANAYQEPVLGPVRGPFPIYQEPVLGPVRGPFPI15mexican frescocheese WSEβ-CaseinNA34C &4CAfter 2h incbtn rennet addn then coagultn for 1h & stoarge 4C after that5d cheese ripeningAce-inhibitoryIn vitroNAspectrophotometeric assay using HHL as substrateLactobacillus caseiproteinase and peptidaseLC-ESI-MS835.0 (+2) 1668.045.3 ± 0.10ug/ml
FMDB33921787916NANAYQEPVLGPVRGPFPIIVYQEPVLGPVRGPFPIIV17mexican frescocheese WSEβ-CaseinNA34C &4CAfter 2h incbtn rennet addn then coagultn for 1h & stoarge 4C after that5d cheese ripeningAce-inhibitoryIn vitroNAspectrophotometeric assay using HHL as substrateLactobacillus caseiproteinase and peptidaseLC-ESI-MS941.4 (+2) 1880.285.3 ± 0.10ug/ml
FMDB34021787916NANAEVLNENLLRFEVLNENLLRF10mexican frescocheese WSEαS1-CaseinNA34C &4CAfter 2h incbtn rennet addn then coagultn for 1h & stoarge 4C after that5d cheese ripeningAce-inhibitoryIn vitroNAspectrophotometeric assay using HHL as substrateLactobacillus caseiproteinase and peptidaseLC-ESI-MS624 (+2) 1236.825.3 ± 0.10ug/ml
FMDB34121787916NANAFVAPFPEVFGKFVAPFPEVFGK11mexican frescocheese WSEαS1-CaseinNA34C &4CAfter 2h incbtn rennet addn then coagultn for 1h & stoarge 4C after that5d cheese ripeningAce-inhibitoryIn vitroNAspectrophotometeric assay using HHL as substrateLactobacillus caseiproteinase and peptidaseLC-ESI-MS619.4 (+2) 1245.865.3 ± 0.10ug/ml
FMDB780NApapdimitriou07Identification of peptides in traditional and probiotic sheep Milk Yogurt with angiotensin I-converting enzyme (ACE)-inhibitory activityDKIHPFAQDKIHPFAQ8sheep Milk Yogurtβ-Casein4.742C4hAce-inhibitoryIn vitroNAACE In hibitory activity using HHL as the substrateL. delbrueckii subsp. bulgaricus γ10.13 and S. thermophillus γ10.7 and L. paracasei subsp. paracasei DC412proteinaseRPHPLC and automated, pulsed liquid-phase protein-peptide sequencerNA NA257uM
FMDB781NAIdentification of peptides in traditional and probiotic sheep Milk Yogurt with angiotensin I-converting enzyme (ACE)-inhibitory activityTQTPVVVPTQTPVVVP8sheep Milk Yogurtβ-Casein4.742C4hAce-inhibitoryIn vitroNAACE In hibitory activity using HHL as the substrateL. delbrueckii subsp. bulgaricus γ10.13 and S. thermophillus γ10.7 and L. paracasei subsp. paracasei DC412proteinaseRPHPLC and automated, pulsed liquid-phase protein-peptide sequencerNA NA173uM
FMDB782NAIdentification of peptides in traditional and probiotic sheep Milk Yogurt with angiotensin I-converting enzyme (ACE)-inhibitory activityKAVPQKAVPQ5fermented sheep Milkβ-CaseinNA37C18hAce-inhibitoryIn vitroNAACE In hibitory activity using HHL as the substrateL. paracasei subsp. paracasei DC412proteinaseRPHPLC and automated, pulsed liquid-phase protein-peptide sequencerNA NA39uM
FMDB784NAIdentification of peptides in traditional and probiotic sheep Milk Yogurt with angiotensin I-converting enzyme (ACE)-inhibitory activityRPKHPIKHRPKHPIKH8sheep Milk YogurtαS1-Casein4.742C4hAce-inhibitoryIn vitroNAACE In hibitory activity using HHL as the substrateL. delbrueckii subsp. bulgaricus γ10.13 and S. thermophillus γ10.7 and L. paracasei subsp. paracasei DC412proteinaseRPHPLC and automated, pulsed liquid-phase protein-peptide sequencerNA NA40.3uM
FMDB785NAIdentification of peptides in traditional and probiotic sheep Milk Yogurt with angiotensin I-converting enzyme (ACE)-inhibitory activitySQPK YQEPSQPK YQEP9sheep Milk Yogurtβ-Casein4.742C4hAce-inhibitoryIn vitroNAACE In hibitory activity using HHL as the substrateL. delbrueckii subsp. bulgaricus γ10.13 and S. thermophillus γ10.7 and L. paracasei subsp. paracasei DC412proteinaseRPHPLC and automated, pulsed liquid-phase protein-peptide sequencerNA NANA
FMDB786NAIdentification of peptides in traditional and probiotic sheep Milk Yogurt with angiotensin I-converting enzyme (ACE)-inhibitory activityNQFLPYPYNQFLPYPY8sheep Milk Yogurtk-Casein4.742C4hAce-inhibitoryIn vitroNAACE In hibitory activity using HHL as the substrateL. delbrueckii subsp. bulgaricus γ10.13 and S. thermophillus γ10.7 and L. paracasei subsp. paracasei DC412proteinaseRPHPLC and automated, pulsed liquid-phase protein-peptide sequencerNA NANA
FMDB787NAIdentification of peptides in traditional and probiotic sheep Milk Yogurt with angiotensin I-converting enzyme (ACE)-inhibitory activityTQTPVVVPTQTPVVVP8sheep Milk Yogurtβ-Casein4.742C4hAce-inhibitoryIn vitroNAACE In hibitory activity using HHL as the substrateL. delbrueckii subsp. bulgaricus γ10.13 and S. thermophillus γ10.7 and L. paracasei subsp. paracasei DC412proteinaseRPHPLC and automated, pulsed liquid-phase protein-peptide sequencerNA NANA
FMDB788NAIdentification of peptides in traditional and probiotic sheep Milk Yogurt with angiotensin I-converting enzyme (ACE)-inhibitory activityYPVEPFTEYPVEPFTE8sheep Milk Yogurtβ-Casein4.742C4hAce-inhibitoryIn vitroNAACE In hibitory activity using HHL as the substrateL. delbrueckii subsp. bulgaricus γ10.13 and S. thermophillus γ10.7 and L. paracasei subsp. paracasei DC412proteinaseRPHPLC and automated, pulsed liquid-phase protein-peptide sequencerNA NA0.37mg/ml
FMDB789NAIdentification of peptides in traditional and probiotic sheep Milk Yogurt with angiotensin I-converting enzyme (ACE)-inhibitory activityGVPKVKGVPKVK6fermented sheep Milkβ-CaseinNA37C18hAce-inhibitoryIn vitroNAACE In hibitory activity using HHL as the substrateL. paracasei subsp. paracasei DC412proteinaseRPHPLC and automated, pulsed liquid-phase protein-peptide sequencerNA NANA
FMDB791NAIdentification of peptides in traditional and probiotic sheep Milk Yogurt with angiotensin I-converting enzyme (ACE)-inhibitory activityGVPKVKEGVPKVKE7fermented sheep Milkβ-CaseinNA38C18hAce-inhibitoryIn vitroNAACE In hibitory activity using HHL as the substrateL. delbrueckii subsp. bulgaricus γ10.13 and S. thermophillus γ10.7 and L. paracasei subsp. paracasei DC412proteinaseRPHPLC and automated, pulsed liquid-phase protein-peptide sequencerNA NANA
FMDB79225829629NANATYKEETYKEE5skim Milk YogurtαS2-Casein4.542C for L. delbrueckii ssp. bulgaricus Lb1466 and 37C for others12hAce-inhibitoryIn vitroNAspectrophotometric assay using HHL as substrateL. delbrueckii ssp. bulgaricus Lb1466 and S. thermophilus St1342 and L. acidophilus L10, L. casei L26 and B. lactis B94proteinase and peptidaseRPHPLC and automated Edman degradation on Applied Biosystem Procise protein/peptide sequencerNA NA12.41+/-0.46ug/ml
FMDB79325829629NANAIPPIPP3skim Milk Yogurtβ-Casein4.542C for L. delbrueckii ssp. bulgaricus Lb1466 and 37C for others12hAce-inhibitoryIn vitroNAspectrophotometric assay using HHL as substrateL. delbrueckii ssp. bulgaricus Lb1466 and S. thermophilus St1342 and L. acidophilus L10, L. casei L26 and B. lactis B95proteinase and peptidaseRPHPLC and automated Edman degradation on Applied Biosystem Procise protein/peptide sequencerNA NA11.6uM
FMDB79425829629NANAIPPIPP3skim Milk Yogurtk-Casein4.542C for L. delbrueckii ssp. bulgaricus Lb1466 and 37C for others12hAce-inhibitoryIn vitroNAspectrophotometric assay using HHL as substrateL. delbrueckii ssp. bulgaricus Lb1466 and S. thermophilus St1342 and L. acidophilus L10, L. casei L26 and B. lactis B96proteinase and peptidaseRPHPLC and automated Edman degradation on Applied Biosystem Procise protein/peptide sequencerNA NA11.6uM
FMDB79525829629NANAYQQPVLYQQPVL6skim Milk Yogurtβ-Casein4.542C for L. delbrueckii ssp. bulgaricus Lb1466 and 37C for others12hAce-inhibitoryIn vitroNASpectrophotometric assay using HHL as substateL. delbrueckii ssp. bulgaricus Lb1466 and S. thermophilus St1342 and L. acidophilus L10, L. casei L26 and B. lactis B96proteinase and peptidaseRPHPLC and automated Edman degradation on Applied Biosystem Procise protein/peptide sequencerNA NA6.09+/-0.46ug/ml
FMDB79625829629NANARINKKRINKK5skim Milk Yogurtβ-Casein4.542C for L. delbrueckii ssp. bulgaricus Lb1466 and 37C for others12hAce-inhibitoryIn vitroNASpectrophotometric assay using HHL as substateL. delbrueckii ssp. bulgaricus Lb1466 and S. thermophilus St1342 and L. acidophilus L10, L. casei L26 and B. lactis B97proteinase and peptidaseRPHPLC and automated Edman degradation on Applied Biosystem Procise protein/peptide sequencerNA NA12.05+/-0.93ug/ml
FMDB79725829629NANASLPQNSLPQN5skim Milk Yogurtβ-Casein4.542C for L. delbrueckii ssp. bulgaricus Lb1466 and 37C for others12hAce-inhibitoryIn vitroNASpectrophotometric assay using HHL as substateL. delbrueckii ssp. bulgaricus Lb1466 and S. thermophilus St1342 and L. acidophilus L10, L. casei L26 and B. lactis B98proteinase and peptidaseRPHPLC and automated Edman degradation on Applied Biosystem Procise protein/peptide sequencerNA NA5.29±0.55ug/ml
FMDB79825829629NANAVPPVPP3skim Milk Yogurtβ-Casein4.542C for L. delbrueckii ssp. bulgaricus Lb1466 and 37C for others12hAce-inhibitoryIn vitroNASpectrophotometric assay using HHL as substateL. delbrueckii ssp. bulgaricus Lb1466 and S. thermophilus St1342 and L. acidophilus L10, L. casei L26 and B. lactis B99proteinase and peptidaseRPHPLC and automated Edman degradation on Applied Biosystem Procise protein/peptide sequencerNA NA8.4uM
FMDB79925829629NANAARHPHARHPH5skim Milk Yogurtk-Casein4.542C for L. delbrueckii ssp. bulgaricus Lb1466 and 37C for others12hAce-inhibitoryIn vitroNASpectrophotometric assay using HHL as substateL. delbrueckii ssp. bulgaricus Lb1466 and S. thermophilus St1342 and L. acidophilus L10, L. casei L26 and B. lactis B100proteinase and peptidaseRPHPLC and automated Edman degradation on Applied Biosystem Procise protein/peptide sequencerNA NA9.64±3.67ug/ml
FMDB80016162521NANALEIVPKLEIVPK6caprine kefirαS1-CaseinNANANANANANANALactococcus lactis, lactococcus cremoris, Lactococcus biovar. Diacetylactis, leuconostoc meenterides ssp. Cremoris, lacobacillus plantarum, lactobacillus casei, and the Kluveromyces marxianus var. fragilisproteinase and peptidaseon line RP-HPLC-tandem Mass spectrometeryNA 697.4 ± 0.06>1000 µM
FMDB80116162521NANADKIHPFDKIHPF6caprine kefirβ-CaseinNANANANANANANALactococcus lactis, lactococcus cremoris, Lactococcus biovar. Diacetylactis, leuconostoc meenterides ssp. Cremoris, lacobacillus plantarum, lactobacillus casei, and the Kluveromyces marxianus var. fragilisproteinase and peptidaseon line RP-HPLC-tandem Mass spectrometeryNA 755.4 ± 0.08>1000 µM
FMDB80216162521NANAKIHPFAQAQKIHPFAQAQ9caprine kefirβ-CaseinNANANAAce-inhibitoryIn vitroNASpectrophotometric assay using HHL as substateLactococcus lactis, lactococcus cremoris, Lactococcus biovar. Diacetylactis, leuconostoc meenterides ssp. Cremoris, lacobacillus plantarum, lactobacillus casei, and the Kluveromyces marxianus var. fragilisproteinase and peptidaseon line RP-HPLC-tandem Mass spectrometeryNA 1038.4 ± 0.02132.6 ± 14.1 µM
FMDB80316162521NANAQLLKLKQLLKLK6caprine kefirαS1-CaseinNANANANANANANALactococcus lactis, lactococcus cremoris, Lactococcus biovar. Diacetylactis, leuconostoc meenterides ssp. Cremoris, lacobacillus plantarum, lactobacillus casei, and the Kluveromyces marxianus var. fragilisproteinase and peptidaseon line RP-HPLC-tandem Mass spectrometeryNA 741.5 ± 0.08342.4 ± 32.1 µM
FMDB80416162521NANALNVVGETVELNVVGETVE9caprine kefirβ-CaseinNANANANANANANALactococcus lactis, lactococcus cremoris, Lactococcus biovar. Diacetylactis, leuconostoc meenterides ssp. Cremoris, lacobacillus plantarum, lactobacillus casei, and the Kluveromyces marxianus var. fragilisproteinase and peptidaseon line RP-HPLC-tandem Mass spectrometeryNA 958.3 ± 0.04>1000 µM
FMDB80516162521NANAGVPKVKETMVPKGVPKVKETMVPK12caprine kefirβ-CaseinNANANANANANANALactococcus lactis, lactococcus cremoris, Lactococcus biovar. Diacetylactis, leuconostoc meenterides ssp. Cremoris, lacobacillus plantarum, lactobacillus casei, and the Kluveromyces marxianus var. fragilisproteinase and peptidaseon line RP-HPLC-tandem Mass spectrometeryNA 1311.5 ± 0.04376.1 ± 36.9
FMDB80616162521NANAGVPKVKETMVPKHGVPKVKETMVPKH13caprine kefirβ-CaseinNANANAAce-inhibitoryIn vitroNASpectrophotometric assay using HHL as substateLactococcus lactis, lactococcus cremoris, Lactococcus biovar. Diacetylactis, leuconostoc meenterides ssp. Cremoris, lacobacillus plantarum, lactobacillus casei, and the Kluveromyces marxianus var. fragilisproteinase and peptidaseon line RP-HPLC-tandem Mass spectrometeryNA 1448.5 ± 0.08223.2 ± 21.3
FMDB80716162521NANAIPAINIPAIN5caprine kefirk-CaseinNANANANANANANALactococcus lactis, lactococcus cremoris, Lactococcus biovar. Diacetylactis, leuconostoc meenterides ssp. Cremoris, lacobacillus plantarum, lactobacillus casei, and the Kluveromyces marxianus var. fragilisproteinase and peptidaseon line RP-HPLC-tandem Mass spectrometeryNA 526.4 ± 0.04432.6 ± 41.6
FMDB80816162521NANAGPFPILVGPFPILV7caprine kefirβ-CaseinNANANANANANANALactococcus lactis, lactococcus cremoris, Lactococcus biovar. Diacetylactis, leuconostoc meenterides ssp. Cremoris, lacobacillus plantarum, lactobacillus casei, and the Kluveromyces marxianus var. fragilisproteinase and peptidaseon line RP-HPLC-tandem Mass spectrometeryNA 741.5 ± 0.04424.0 ± 42.4
FMDB80916162521NANAKFAWPQKFAWPQ6caprine kefirαS2-CaseinNANANAAce-inhibitoryIn vitroNASpectrophotometric assay using HHL as substateLactococcus lactis, lactococcus cremoris, Lactococcus biovar. Diacetylactis, leuconostoc meenterides ssp. Cremoris, lacobacillus plantarum, lactobacillus casei, and the Kluveromyces marxianus var. fragilisproteinase and peptidaseon line RP-HPLC-tandem Mass spectrometeryNA 775.5 ± 0.05177.1 ± 14.9
FMDB81016162521NANATGPIPNSLPQTGPIPNSLPQ10caprine kefirβ-CaseinNANANANANANANALactococcus lactis, lactococcus cremoris, Lactococcus biovar. Diacetylactis, leuconostoc meenterides ssp. Cremoris, lacobacillus plantarum, lactobacillus casei, and the Kluveromyces marxianus var. fragilisproteinase and peptidaseon line RP-HPLC-tandem Mass spectrometeryNA 1022.5 ± 0.02>1000
FMDB81116162521NANAYPFYPF3caprine kefirβ-CaseinNANANANANANANALactococcus lactis, lactococcus cremoris, Lactococcus biovar. Diacetylactis, leuconostoc meenterides ssp. Cremoris, lacobacillus plantarum, lactobacillus casei, and the Kluveromyces marxianus var. fragilisproteinase and peptidaseon line RP-HPLC-tandem Mass spectrometeryNA 425.2 ± 0.02>1000
FMDB81216162521NANAHPFAQHPFAQ5caprine kefirβ-CaseinNANANANANANANALactococcus lactis, lactococcus cremoris, Lactococcus biovar. Diacetylactis, leuconostoc meenterides ssp. Cremoris, lacobacillus plantarum, lactobacillus casei, and the Kluveromyces marxianus var. fragilisproteinase and peptidaseon line RP-HPLC-tandem Mass spectrometeryNA 598.4 ± 0.04465.0 ± 43.4
FMDB81316162521NANAENLLRFENLLRF6caprine kefirαS1-CaseinNANANAAce-inhibitoryIn vitroNASpectrophotometric assay using HHL as substateLactococcus lactis, lactococcus cremoris, Lactococcus biovar. Diacetylactis, leuconostoc meenterides ssp. Cremoris, lacobacillus plantarum, lactobacillus casei, and the Kluveromyces marxianus var. fragilisproteinase and peptidaseon line RP-HPLC-tandem Mass spectrometeryNA 790.4 ± 0.0682.4 ± 8.9
FMDB81416162521NANAPYVRYLPYVRYL6caprine kefirαS2-CaseinNANANAAce-inhibitoryIn vitroNASpectrophotometric assay using HHL as substateLactococcus lactis, lactococcus cremoris, Lactococcus biovar. Diacetylactis, leuconostoc meenterides ssp. Cremoris, lacobacillus plantarum, lactobacillus casei, and the Kluveromyces marxianus var. fragilisproteinase and peptidaseon line RP-HPLC-tandem Mass spectrometeryNA 809.4 ± 0.072.4 ± 0.2
FMDB81516162521NANALVYPFTGPIPNLVYPFTGPIPN11caprine kefirβ-CaseinNANANAAce-inhibitoryIn vitroNASpectrophotometric assay using HHL as substateLactococcus lactis, lactococcus cremoris, Lactococcus biovar. Diacetylactis, leuconostoc meenterides ssp. Cremoris, lacobacillus plantarum, lactobacillus casei, and the Kluveromyces marxianus var. fragilisproteinase and peptidaseon line RP-HPLC-tandem Mass spectrometeryNA 1216.5 ± 0.0127.9 ± 2.3
FMDB816NAronquillo12Antithrombotic and angiotensin-converting enzyme inhibitory properties of peptides released from bovine Casein by Lactobacillus casei ShirotaYQEPVLGPVRGPFPIIVYQEPVLGPVRGPFPIIV17Casein mediumβ-CaseinNA37c42hAntithromboticIn vitroNAThrombin inhibition assayLactobacillus caseiShirota and Streptococcus thermophilusNAMALDI-TOF/TOF MSNA 1.88KdaIER value of 0.14%/peptide concentration (mg mL1
FMDB817NAAntithrombotic and angiotensin-converting enzyme inhibitory properties of peptides released from bovine Casein by Lactobacillus casei ShirotaYQEPVLGPVRGPFPIIVYQEPVLGPVRGPFPIIV17Casein mediumβ-CaseinNA34c24hAce-inhibitoryIn vitroNASpectrophotometric assay using HHL as substateLactobacillus caseiShirota and Streptococcus thermophilusNAMALDI-TOF/TOF MSNA NANA
FMDB862NAong07Angiotensin converting enzyme-inhibitory activity in Cheddar cheeses made with the addition of probiotic Lactobacillus casei sp.RPKHPIKHQRPKHPIKHQ9WSE of Cheddar cheeseαS1-CaseinNA4c24wkAce-inhibitoryIn vitroNASpectrophotometric assay using hippuryl-L-histidyl-L-leucine substrateL. lactis subsp. lactis and L. lactis subsp. Cremoris and Lb. casei LAFTI® L26.proteinase and peptidasesRPHPLC; Edman degradation method using protein sequencer and MALDI-TOF-MSNA 1140.7g/mol0.25mg/ml
FMDB863NAong07Angiotensin converting enzyme-inhibitory activity in Cheddar cheeses made with the addition of probiotic Lactobacillus casei sp.RPKHPIKRPKHPIK7WSE of Cheddar cheeseαS1-CaseinNA4c24wkAce-inhibitoryIn vitroNASpectrophotometric assay using hippuryl-L-histidyl-L-leucine substrateL. lactis subsp. lactis and L. lactis subsp. Cremoris and Lb. casei LAFTI® L26.proteinase and peptidasesRPHPLC; Edman degradation method using protein sequencer and MALDI-TOF-MSNA 877g/mol0.25mg/ml
FMDB864NAong07Angiotensin converting enzyme-inhibitory activity in Cheddar cheeses made with the addition of probiotic Lactobacillus casei sp.RPKHPIRPKHPI6WSE of Cheddar cheeseαS1-CaseinNA4c24wkAce-inhibitoryIn vitroNASpectrophotometric assay using hippuryl-L-histidyl-L-leucine substrateL. lactis subsp. lactis and L. lactis subsp. Cremoris and Lb. casei LAFTI® L26.proteinase and peptidasesRPHPLC; Edman degradation method using protein sequencer and MALDI-TOF-MSNA 745.4g/mol0.25mg/ml
FMDB865NAong07Angiotensin converting enzyme-inhibitory activity in Cheddar cheeses made with the addition of probiotic Lactobacillus casei sp.DKIHPFDKIHPF6WSE of Cheddar cheeseβ-CaseinNA4c24wkAce-inhibitoryIn vitroNASpectrophotometric assay using hippuryl-L-histidyl-L-leucine substrateL. lactis subsp. lactis and L. lactis subsp. Cremoris and Lb. casei LAFTI® L26.proteinase and peptidasesRPHPLC; Edman degradation method using protein sequencer and MALDI-TOF-MSNA 755.4g/mol0.14mg/ml
FMDB866NAong07Angiotensin converting enzyme-inhibitory activity in Cheddar cheeses made with the addition of probiotic Lactobacillus casei sp.FVAPFPEVFFVAPFPEVF9WSE of Cheddar cheeseαS1-CaseinNA4c24wkAce-inhibitoryIn vitroNASpectrophotometric assay using hippuryl-L-histidyl-L-leucine substrateL. lactis subsp. lactis and L. lactis subsp. Cremoris and Lb. casei LAFTI® L26.proteinase and peptidasesRPHPLC; Edman degradation method using protein sequencer and MALDI-TOF-MSNA 1053.3g/mol0.11mg/ml
FMDB867NAong07Angiotensin converting enzyme-inhibitory activity in Cheddar cheeses made with the addition of probiotic Lactobacillus casei sp.KKYKVPQLEKKYKVPQLE9WSE of Cheddar cheeseαS1-CaseinNA4c24wkAce-inhibitoryIn vitroNASpectrophotometric assay using hippuryl-L-histidyl-L-leucine substrateL. lactis subsp. lactis and L. lactis subsp. Cremoris and Lb. casei LAFTI® L26.proteinase and peptidasesRPHPLC; Edman degradation method using protein sequencer and MALDI-TOF-MSNA 1132.4g/mol0.11mg/ml
FMDB868NAong07Angiotensin converting enzyme-inhibitory activity in Cheddar cheeses made with the addition of probiotic Lactobacillus casei sp.YQEPVLGPVRGPFPIIVYQEPVLGPVRGPFPIIV17WSE of Cheddar cheeseβ-CaseinNA4c24wkAce-inhibitoryIn vitroNASpectrophotometric assay using hippuryl-L-histidyl-L-leucine substrateL. lactis subsp. lactis and L. lactis subsp. Cremoris and Lb. casei LAFTI® L26.proteinase and peptidasesRPHPLC; Edman degradation method using protein sequencer and MALDI-TOF-MSNA 1881.1g/mol0.14mg/ml
FMDB869NAong07Angiotensin converting enzyme-inhibitory activity in Cheddar cheeses made with the addition of probiotic Lactobacillus casei sp.RPKHPIKHQRPKHPIKHQ9WSE of Cheddar cheeseαS1-CaseinNA4c24wkAce-inhibitoryIn vitroNASpectrophotometric assay using hippuryl-L-histidyl-L-leucine substrateL. lactis subsp. lactis and L. lactis subsp. Cremoris and Lb. casei 279proteinase and peptidasesRPHPLC; Edman degradation method using protein sequencer and MALDI-TOF-MSNA 1140.7g/mol0.18mg/ml
FMDB870NAong07Angiotensin converting enzyme-inhibitory activity in Cheddar cheeses made with the addition of probiotic Lactobacillus casei sp.RPKHPIKRPKHPIK7WSE of Cheddar cheeseαS1-CaseinNA4c24wkAce-inhibitoryIn vitroNASpectrophotometric assay using hippuryl-L-histidyl-L-leucine substrateL. lactis subsp. lactis and L. lactis subsp. Cremoris and Lb. casei 279proteinase and peptidasesRPHPLC; Edman degradation method using protein sequencer and MALDI-TOF-MSNA 877g/mol0.18mg/ml
FMDB871NAong07Angiotensin converting enzyme-inhibitory activity in Cheddar cheeses made with the addition of probiotic Lactobacillus casei sp.RPKHPIRPKHPI6WSE of Cheddar cheeseαS1-CaseinNA4c24wkAce-inhibitoryIn vitroNASpectrophotometric assay using hippuryl-L-histidyl-L-leucine substrateL. lactis subsp. lactis and L. lactis subsp. Cremoris and Lb. casei 279proteinase and peptidasesRPHPLC; Edman degradation method using protein sequencer and MALDI-TOF-MSNA 745.4g/mol0.18mg/ml
FMDB872NAong07Angiotensin converting enzyme-inhibitory activity in Cheddar cheeses made with the addition of probiotic Lactobacillus casei sp.DKIHPFDKIHPF6WSE of Cheddar cheeseβ-CaseinNA4c24wkAce-inhibitoryIn vitroNASpectrophotometric assay using hippuryl-L-histidyl-L-leucine substrateL. lactis subsp. lactis and L. lactis subsp. Cremoris and Lb. casei 279proteinase and peptidasesRPHPLC; Edman degradation method using protein sequencer and MALDI-TOF-MSNA 755.4g/mol0.12mg/ml
FMDB873NAong07Angiotensin converting enzyme-inhibitory activity in Cheddar cheeses made with the addition of probiotic Lactobacillus casei sp.FVAPFPEVFFVAPFPEVF9WSE of Cheddar cheeseαS1-CaseinNA4c24wkAce-inhibitoryIn vitroNASpectrophotometric assay using hippuryl-L-histidyl-L-leucine substrateL. lactis subsp. lactis and L. lactis subsp. Cremoris and Lb. casei 279proteinase and peptidasesRPHPLC; Edman degradation method using protein sequencer and MALDI-TOF-MSNA 1053.3g/mol0.09mg/ml
FMDB874NAong07Angiotensin converting enzyme-inhibitory activity in Cheddar cheeses made with the addition of probiotic Lactobacillus casei sp.KKYKVPQLEKKYKVPQLE9WSE of Cheddar cheeseαS1-CaseinNA4c24wkAce-inhibitoryIn vitroNASpectrophotometric assay using hippuryl-L-histidyl-L-leucine substrateL. lactis subsp. lactis and L. lactis subsp. Cremoris and Lb. casei 279proteinase and peptidasesRPHPLC; Edman degradation method using protein sequencer and MALDI-TOF-MSNA 1132.4g/mol0.09mg/ml
FMDB875NAong07Angiotensin converting enzyme-inhibitory activity in Cheddar cheeses made with the addition of probiotic Lactobacillus casei sp.YQEPVLGPVRGPFPIIVYQEPVLGPVRGPFPIIV17WSE of Cheddar cheeseβ-CaseinNA4c24wkAce-inhibitoryIn vitroNASpectrophotometric assay using hippuryl-L-histidyl-L-leucine substrateL. lactis subsp. lactis and L. lactis subsp. Cremoris and Lb. casei 279proteinase and peptidasesRPHPLC; Edman degradation method using protein sequencer and MALDI-TOF-MSNA 1881.1g/mol0.17mg/ml
FMDB990NAvallabha13Antihypertensive Peptides Derived from soy Protein by FermentationLIVTQLIVTQ5Fermented soy protein (Defatted soya flour)NANA37C36hAce-inhibitoryIn vitroNASpectrophotometric assay using HHL as substrateLactobacillus caseispp. pseudoplantarumNARPHPLC and sequence determination by Edman degradatiojn usng Applied Biosystems 477-A gas phase sequencerNA NA0.087uM
FMDB991NAAntihypertensive Peptides Derived from soy Protein by FermentationLIVTLIVT4Fermented soy protein (Defatted soya flour)NANA37C36hAce-inhibitoryIn vitroNASpectrophotometric assay using HHL as substrateLactobacillus caseispp. pseudoplantarumNARPHPLC and sequence determination by Edman degradatiojn usng Applied Biosystems 477-A gas phase sequencerNA NA0.11uM
FMDB1669NAronquillo12Antithrombotic and angiotensin-converting enzyme inhibitory properties of peptides released from bovine Casein by Lactobacillus casei ShirotaYQEPVLGPVRGPFPIIVYQEPVLGPVRGPFPIIV17Casein mediumBovine ( β-Casein)937c42hAce-inhibitoryIn vitroNAspectrophotometric assay using HHL as substrateLb. casei Shirota and St. thermophilusNAMALDI-TOF/TOF MSNA 1.88 KdaIER value of 0.14%/peptide concentration (mg/mL)
FMDB1670NAAntithrombotic and angiotensin-converting enzyme inhibitory properties of peptides released from bovine Casein by Lactobacillus casei ShirotaYQEPVLGPVRGPFPIIVYQEPVLGPVRGPFPIIV17Casein mediumBovine ( β-Casein)937c42hAntithromboticIn vitroNAThrombin inhibition assayLb. casei ShirotaNAMALDI-TOF/TOF MSNA 1.88 KdaIER of thrombin with 4.6%/peptide concentration (mg/ mL)
FMDB1671NAlozo11Comparative analysis of b-Casein proteolysis by PrtP proteinase from Lactobacillus paracasei subsp. paracasei BGHN14, PrtR proteinase from Lactobacillus rhamnosus BGT10 and PrtH proteinase from Lactobacillus helveticus BGRA43SLSQSSLSQS5Beta Caseinβ-Casein6.830C3hNANANANALactobacillus paracasei subsp. paracasei BGHN14cell-envelope proteinases PrtPLC MS/MSNA 519.9 daNA
FMDB1674NAlozo11NAQEPVQEPV4Beta Caseinβ-Casein6.830C3hNANANANALactobacillus paracasei subsp. paracasei BGHN14cell-envelope proteinasesPrtPLC MS/MSNA 584.1DaNA
FMDB1677NAlozo11NADMPIQDMPIQ5Beta Caseinβ-Casein6.830C3hNANANANALactobacillus paracasei subsp. paracasei BGHN14cell-envelope proteinasesPrtPLC MS/MSNA 601.9DaNA
FMDB1683NAlozo11NAEAMAPKEAMAPK6Beta Caseinβ-Casein6.830C3hNANANANALactobacillus paracasei subsp. paracasei BGHN14cell-envelope proteinasesPrtPLC MS/MSNA 645.1 daNA
FMDB1686NAlozo11NAAVPYPQAVPYPQ6Beta Caseinβ-Casein6.830C3hNANANANALactobacillus paracasei subsp. paracasei BGHN14cell-envelope proteinasesPrtPLC MS/MSNA 673.1DaNA
FMDB1693NAlozo11NAYQEPVLYQEPVL6Beta Caseinβ-Casein6.830C3hNANANANALactobacillus paracasei subsp. paracasei BGHN14cell-envelope proteinasesPrtPLC MS/MSNA 747.1 daNA
FMDB1696NAlozo11NARDMPIQRDMPIQ6Beta Caseinβ-Casein6.830C3hNANANANALactobacillus paracasei subsp. paracasei BGHN14cell-envelope proteinasesPrtPLC MS/MSNA 758.7 daNA
FMDB1699NAlozo11NAKVLPVPQKVLPVPQ7Beta Caseinβ-Casein6.830C3hNANANANALactobacillus paracasei subsp. paracasei BGHN14cell-envelope proteinasesPrtPLC MS/MSNA 779.4 DaNA
FMDB1700NAlozo11NAKAVPYPQKAVPYPQ7Beta Caseinβ-Casein6.830C3hNANANANALactobacillus paracasei subsp. paracasei BGHN14cell-envelope proteinasesPrtPLC MS/MSNA 801.3 DaNA
FMDB1702NAlozo11NAGVSKVKEAGVSKVKEA8Beta Caseinβ-Casein6.830C3hNANANANALactobacillus paracasei subsp. paracasei BGHN14cell-envelope proteinasesPrtPLC MS/MSNA 816.3DaNA
FMDB1703NAlozo11NASVLSLSQSSVLSLSQS8Beta Caseinβ-Casein6.830C3hNANANANALactobacillus paracasei subsp. paracasei BGHN14cell-envelope proteinasesPrtPLC MS/MSNA 819.2DaNA
FMDB1704NAlozo11NAGPVRGPFPGPVRGPFP8Beta Caseinβ-Casein6.830C3hNANANANALactobacillus paracasei subsp. paracasei BGHN14cell-envelope proteinasesPrtPLC MS/MSNA 825.4DaNA
FMDB1706NAlozo11NARDMPIQARDMPIQA7Beta Caseinβ-Casein6.830C3hNANANANALactobacillus paracasei subsp. paracasei BGHN14cell-envelope proteinasesPrtPLC MS/MSNA 829.4DaNA
FMDB1708NAlozo11NALLYQEPVLLLYQEPVL8Beta Caseinβ-Casein6.830C3hNANANANALactobacillus paracasei subsp. paracasei BGHN14cell-envelope proteinasesPrtPLC MS/MSNA 973.3DaNA
FMDB1709NAlozo11NARDMPIQAFRDMPIQAF8Beta Caseinβ-Casein6.830C3hNANANANALactobacillus paracasei subsp. paracasei BGHN14cell-envelope proteinasesPrtPLC MS/MSNA 976.4DaNA
FMDB1710NAlozo11NAKVKEAMAPKKVKEAMAPK9Beta Caseinβ-Casein6.830C3hNANANANALactobacillus paracasei subsp. paracasei BGHN14cell-envelope proteinasesPrtPLC MS/MSNA 1000.4DaNA
FMDB1711NAlozo11NAGPVRGPFPIIVGPVRGPFPIIV11Beta Caseinβ-Casein6.830C3hNANANANALactobacillus paracasei subsp. paracasei BGHN14cell-envelope proteinasesPrtPLC MS/MSNA 1150.7DaNA
FMDB1714NAlozo11NAHQPHQPLPPTVMHQPHQPLPPTVM12Beta Caseinβ-Casein6.830C3hNANANANALactobacillus paracasei subsp. paracasei BGHN14cell-envelope proteinasesPrtPLC MS/MSNA 1380.4DaNA
FMDB1715NAlozo11NAQEPVLGPVRGPFPQEPVLGPVRGPFP13Beta Caseinβ-Casein6.830C3hNANANANALactobacillus paracasei subsp. paracasei BGHN14cell-envelope proteinasesPrtPLC MS/MSNA 1391.5DaNA
FMDB1717NAlozo11NAYQEPVLGPVRGPFPYQEPVLGPVRGPFP14Beta Caseinβ-Casein6.830C3hNANANANALactobacillus paracasei subsp. paracasei BGHN14cell-envelope proteinasesPrtPLC MS/MSNA 1554.5DaNA
FMDB1719NAlozo11NAQEPVLGPVRGPFPIIVQEPVLGPVRGPFPIIV16Beta Caseinβ-Casein6.830C3hNANANANALactobacillus paracasei subsp. paracasei BGHN14cell-envelope proteinasesPrtPLC MS/MSNA 1716.9DaNA
FMDB1721NAlozo11NAHKEMPFPKYPVEPFHKEMPFPKYPVEPF14Beta Caseinβ-Casein6.830C3hNANANANALactobacillus paracasei subsp. paracasei BGHN14cell-envelope proteinasesPrtPLC MS/MSNA 1745.3DaNA
FMDB1722NAlozo11NALLYQEPVLGPVRGPFPLLYQEPVLGPVRGPFP16Beta Caseinβ-Casein6.830C3hNANANANALactobacillus paracasei subsp. paracasei BGHN14cell-envelope proteinasesPrtPLC MS/MSNA 1780.9DaNA
FMDB1724NAlozo11NAYQEPVLGPVRGPFPIIVYQEPVLGPVRGPFPIIV17Beta Caseinβ-Casein6.830C3hNANANANALactobacillus paracasei subsp. paracasei BGHN14cell-envelope proteinasesPrtPLC MS/MSNA 1879.9DaNA
FMDB1725NAlozo11NAMHQPHQPLPPTVMFPPQMHQPHQPLPPTVMFPPQ17Beta Caseinβ-Casein6.830C3hNANANANALactobacillus paracasei subsp. paracasei BGHN14cell-envelope proteinasesPrtPLC MS/MSNA 1980.8DaNA
FMDB1966NAamadou13Purification and characterization of foxtail millet-derived peptides with antioxidant and antimicrobial activitiesSGYYMHSGYYMH6defatted foxtail millet mealNANA37c48hAntioxidantIn vitroNADPPH scavenging activityand the superoxide anion (O2 •−) scavenging activityL. paracasei Fn032NAHPLC MALDI–TOF–TOF MSNA 756.84 daNA
FMDB1967NAamadou13Purification and characterization of foxtail millet-derived peptides with antioxidant and antimicrobial activitiesLGTFQNLGTFQN6defatted foxtail millet mealNANA37c48hAntioxidantIn vitroNADPPH scavenging activityand the superoxide anion (O2 •−) scavenging activityL. paracasei Fn032NAHPLC MALDI–TOF–TOF MSNA 678.74 DaNA
FMDB1968NAamadou13Purification and characterization of foxtail millet-derived peptides with antioxidant and antimicrobial activitiesLHALLLLHALLL6defatted foxtail millet mealNANA37c48hAntioxidantIn vitroNADPPH scavenging activityand the superoxide anion (O2 •−) scavenging activityL. paracasei Fn032NAHPLC MALDI–TOF–TOF MSNA 678.87 DaNA
FMDB1969NAamadou13Purification and characterization of foxtail millet-derived peptides with antioxidant and antimicrobial activitiesSGYYMHSGYYMH6defatted foxtail millet mealNANA37c48hAnti-microbial against E. coli ATCC 8099In vitroNAwell diffusion assayL. paracasei Fn032NAHPLC MALDI–TOF–TOF MSNA 756.84 daNA
FMDB1970NAamadou13Purification and characterization of foxtail millet-derived peptides with antioxidant and antimicrobial activitiesLGTFQNLGTFQN6defatted foxtail millet mealNANA37c48hAnti-microbial against E. coli ATCC 8099In vitroNAwell diffusion assayL. paracasei Fn032NAHPLC MALDI–TOF–TOF MSNA 678.74 DaNA
FMDB1971NAamadou13Purification and characterization of foxtail millet-derived peptides with antioxidant and antimicrobial activitiesLHALLLLHALLL6defatted foxtail millet mealNANA37c48hAnti-microbial against E. coli ATCC 8099In vitroNAwell diffusion assayL. paracasei Fn032NAHPLC MALDI–TOF–TOF MSNA 678.87 DaNA
FMDB2119NANANAVKEAMAPKVKEAMAPK8Cheddar cheeseβ-CaseinNANANAAntioxidantIn vitroNANALactobacillus casei ssp. casei 300NALC-MS/MSNA 872.5048NA
FMDB2120NANANAHIQKEDVPSERHIQKEDVPSER11Cheddar cheeseαS1-CaseinNANANAAntioxidantIn vitroNANALactobacillus casei ssp. casei 300NALC-MS/MSNA 1336.7034NA