Browse result page of CPPsite 2.0
The total number entries retrieved from this search are 741| ID | PEPTIDE SEQUENCE | PEPTIDE NAME | LENGTH | CHIRALITY | LINEAR/CYCLIC | SOURCE | CATEGORY | N TERMINAL MODIFICATION | C TERMINAL MODIFICATION | CHEMICAL MODIFICATION | CARGO | PUBMED ID |
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 2068 | RRRRRRRRRRR | R11 | 11 | L | Linear | Synthetic | Cationic | Free | Free | NA | Nucleic acid (pDNA) | 23534410 |
| 2069 | CVSRRRRRRGGRRRR | LMWP | 15 | L | Linear | Synthetic | Cationic | Free | Free | NA | Nanoparticles and Fluoriophore (coumarin-6) | 23350619 |
| 2070 | EEEEEEEEEE-PLGLAG-VSRRRRRRGGRRRR | ALWMP | 24 | L | Linear | Synthetic | NA | Free | Free | Linker (PLGLAG) | Nanoparticles and Fluoriophore (coumarin-6) | 23350619 |
| 2081 | CRGDKGPDC | iRGD-CDD | 9 | L | Linear | Synthetic | NA | Free | Free | NA | Fluorophore (Red fluorophor Dy550) | 23248118 |
| 2082 | ARRRAARAARRRAARAARRRAARAARRRAARA | 32 A-R | 32 | L | Linear | Synthetic | NA | Free | Free | NA | Nucleic acid (DNA labelled with FITC) | 23454086 |
| 2083 | AKKKAAKAAKKKAAKAAKKKAAKAAKKKAAKA | 32 A-K | 32 | L | Linear | Synthetic | NA | Free | Free | NA | Nucleic acid (DNA labelled with FITC) | 23454086 |
| 2084 | ARRRAARAARRRAARAARRRAARA | 24 A-R | 24 | L | Linear | Synthetic | NA | Free | Free | NA | Nucleic acid (DNA labelled with FITC) | 23454086 |
| 2085 | AKKKAAKAAKKKAAKAAKKKAAKA | 24 A-K | 24 | L | Linear | Synthetic | NA | Free | Free | NA | Nucleic acid (DNA labelled with FITC) | 23454086 |
| 2086 | ARRARAARRARAARRARAARRARAARRARA | 30 A-R | 30 | L | Linear | Synthetic | NA | Free | Free | NA | Nucleic acid (DNA labelled with FITC) | 23454086 |
| 2087 | AKKAKAAKKAKAAKKAKAAKKAKAAKKAKA | 30 A-K | 30 | L | Linear | Synthetic | NA | Free | Free | NA | Nucleic acid (DNA labelled with FITC) | 23454086 |
| 2088 | RARARARARARARARARARARARARARARARA | 32 RA | 32 | L | Linear | Synthetic | NA | Free | Free | NA | Nucleic acid (DNA labelled with FITC) | 23454086 |
| 2089 | YGRKKRRQRRR | 6His-TAT-Ainp1 | 11 | L | Linear | Protein derived | Cationic | Free | Free | Histidine tagged | Peptide (Ainp1) | 23454269 |
| 2090 | YGRKKRRQRRR | 6His-TAT-GFP | 11 | L | Linear | Protein derived | Cationic | Free | Free | Histidine tagged | Protein (eGFP) | 23454269 |
| 2091 | YGRKKRRQRRR | 6xHis-TAT-SOD | 11 | L | Linear | Protein derived | Cationic | Free | Free | Histidine tagged | Protein (Cu,Zn-superoxide dismutase) | 23289802 |
| 2092 | YTFGLKTSFNVQ | Ypep-GFP | 12 | L | Linear | Protein derived | NA | Free | Free | NA | Protein (eGFP), Phage | 23521800 |
| 2093 | YTFGLKTSFNVQYTFGLKTSFNVQ | Ypep-GFP-Ypep | 24 | L | Linear | Protein derived | NA | Free | Free | NA | Protein (eGFP), Phage | 23521800 |
| 2094 | YGRKKRRQRRR | Tat-GFP | 11 | L | Linear | Protein derived | NA | Free | Free | NA | Protein (eGFP) | 23521800 |
| 2095 | YGRKKRRQRRRYGRKKRRQRRR | Tat-GFP-Tat | 22 | L | Linear | Protein derived | NA | Free | Free | NA | Protein (eGFP) | 23521800 |
| 2096 | RQIKIWFQNRRMKWKK | Pen-GFP | 16 | L | Linear | Protein derived | Amphipathic | Free | Free | NA | Protein (eGFP) | 23521800 |
| 2097 | RQIKIWFQNRRMKWKKRQIKIWFQNRRMKWK | Pen-GFP-Pen | 31 | L | Linear | Protein derived | Amphipathic | Free | Free | NA | Protein (eGFP) | 23521800 |
| 2098 | CRGDK | CRGDK | 5 | L | Linear | Synthetic | NA | Free | Free | NA | Small molecule drug (Doxorubicin), DSPE- PEG2000 | 23634882 |
| 2100 | rrrrrrrrr | 9R | 9 | D | Linear | Synthetic | NA | Biotinylation | Free | NA | Nucleic acid (siRNA) | 24019920 |
| 2101 | RRRRRRRR | GC/R8-Lip | 8 | L | Linear | Synthetic | NA | Stearylation | Free | NA | Protein [GC (-galactosylceramide), ovalbumin] | 23860186 |
| 2102 | LSTAADMQGVVTDGMASGLDKDYLKPDD | p28 | 28 | L | Linear | Protein derived | Anionic | Free | Free | NA | NA | 23736031 |
| 2103 | LSTAADMQGVVTDGMASGLDKDYLKPDD | p28 | 28 | L | Linear | Protein derived | Anionic | Free | Free | NA | NA | 23952735 |
| 2122 | AGYLLGHINLHHLAHLHHILC | TH peptide | 21 | L | Linear | Synthetic | Cationic | Free | Free | NA | Nanoparticle (Liposomes) | 23891517 |
| 2125 | CHHRRRRHHC | CH2 R4 H2 C | 10 | L | Cyclic | Synthetic | NA | Stearylation | Free | NA | Nucleic aciud (siRNA) | 23911914 |
| 2126 | RQIKIWFQNRRMKWKK | L-Penetratin | 16 | L | Linear | Protein derived | Amphipathic | Free | Free | NA | Protein (Insulin) | 24060698 |
| 2127 | KWFKIQMQIRRWKNKR | PenetraMax | 16 | L | Linear | Synthetic | NA | Free | Free | NA | Protein (Insulin) | 24060698 |
| 2128 | TAMRAVDKLLLHLKKLFREGQFNRNFESIIICRDRT | IL-13p | 36 | L | Linear | Protein derived | NA | Free | Free | NA | Fluorophore (Coumarin-6 and DiR) | 24120853 |
| 2129 | YGRKKRRQRRR | TAT-gelonin | 11 | L | Linear | Protein derived | Cationic | Free | Free | NA | Protein (gelonin) | 25204286 |
| 2148 | CIGAVLKVLTTGLPALISWIKRKRQQ | Melittin | 26 | L | Linear | Protein derived | Amphipathic | Free | Free | NA | PNA | 25185512 |
| 2149 | AGYLLGKINLKALAALAKKILGGC | Transportan 10 | 24 | L | Linear | Chimeric | Amphipathic | Free | Free | Linker Di-Glycine | PNA | 25185512 |
| 2150 | GKKALKLAAKLLKKC | GKK peptide | 15 | L | Linear | Synthetic | Amphipathic | Free | Free | NA | PNA | 25185512 |
| 2151 | RRRRRRRQIKILFQNRRMKWKKGGC | R6-Pen(W-L) | 25 | L | Linear | Protein derived | Cationic | Free | Free | Linker Di-Glycine | PNA | 25185512 |
| 2152 | GLFKALLKLLKSLWKLLLKAGGC | ppTG | 23 | L | Linear | Synthetic | NA | Free | Free | Linker Di-Glycine | PNA | 25185512 |
| 2153 | GALFLGWLGAAGSTMGAPKSKRKVGGC | MPG-NLS | 27 | L | Linear | Synthetic | NA | Free | Free | Linker Di-Glycine | PNA | 25185512 |
| 2154 | KWFETWFTEWPKKRKGGC | Pep-3 | 18 | L | Linear | Synthetic | NA | Free | Free | Linker Di-Glycine | PNA | 25185512 |
| 2155 | LIRLWSHLIHIWFQNRRLKWKKKGGC | EB-1 | 26 | L | Linear | Synthetic | Amphipathic | Free | Free | Linker Di-Glycine | PNA | 25185512 |
| 2156 | WEAKLAKALAKALAKHLAKALAKALKACEA | KALA | 30 | L | Linear | Synthetic | Amphipathic | Free | Free | NA | PNA | 25185512 |
| 2157 | MVTVLFRRLRIRRACGPPRVRV | M918 | 22 | L | Linear | Synthetic | NA | Free | Free | NA | PNA | 25185512 |
| 2159 | MVTVLFKRLRIRRACGPPRVKV | M918(R-K) | 22 | L | Linear | Synthetic | NA | Free | Free | NA | PNA | 25185512 |
| 2161 | RQIKIWFQNRRMKWKK | Penetratin | 16 | L | Linear | Protein derived | Cationic and amphipathic | Free | Free | NA | Protein (Insulin) | 24973720 |
| 2162 | rqikiwfqnrrmkwkk | Penetratin | 16 | D | Linear | Protein derived | Cationic and amphipathic | Free | Free | NA | Protein (Insulin) | 24973720 |
| 2163 | WEARLARALARALARHLARALARA | RALA peptide | 24 | L | Linear | Synthetic | Amphipathic | Free | Free | NA | Nucleic acid (pDNA) | 24995949 |
| 2167 | CSKSSDYQC | CSK | 9 | L | Cyclic | Synthetic | NA | Free | Free | Coupling to polyoxyethylene (40) steartae (SA-PEG2000) | Nanoparticle [salmon calcitonin (sCT)-loaded SLNs (Solid Lipid Nanoparticle)] | 24968819 |
| 2168 | IRQRRRR | IRQ | 7 | L | Linear | Synthetic | Cationic | Free | Free | Coupling to polyoxyethylene (40) steartae (SA-PEG2000) | Nanoparticle [salmon calcitonin (sCT)-loaded SLNs (Solid Lipid Nanoparticle)] | 24968819 |
| 2169 | CGYGRKKRRQRRRGC | TAT | 15 | L | Cyclic | Protein derived | Cationic | Free | Free | NA | Nucleic acid (pDNA) | 24985759 |
| 2193 | GRGDSPRR | Pep1 | 8 | L | Linear | Synthetic | Cationic | Acetylation | Free | Phosphorylation | Nucleic acid (Plasmid DNA) | 24462902 |
| 2194 | GRGDSPRRSPRR | Pep2 | 12 | L | Linear | Synthetic | Cationic | Acetylation | Free | Phosphorylation | Nucleic acid (Plasmid DNA) | 24462902 |