Browse result page of PRRDB 2.0

PRRID	Name of Ligand	Source of ligand	Sequence of Ligand	Length of Ligand	Type of Ligand	Occurence	Role of Ligand	Name of Receptor	Type of Reeptor	Source of the Receptor	Localization	Domain	Sequence of Receptor	Swiss prot ID	Length of receptor	Function of Receptor	Assay used	PMID	Year of publication	Pubchem assay
PRRID_1656	tripalmitoyl-S-glycerol cysteine (Pam3Cys) Click for more detail	Bacteria	CCCCCCCCCCCCCCCC(=O)NC(CSCC(COC(=O)CCCCCCCCCCCCCCC)OC(=O)CCCCCCCCCCCCCCC)C(=O)O	NA	Lipopeptides	Synthetic	provide immunostimulatory activity	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	C57BL/6J mice	monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells	Toll/IL-1R (TIR) domain-containing adaptor molecule MyD88 (myeloid differentiation factor 88)-dependent pathway	Q9QUN7.fasta	Q9QUN7	784	significant role in the pathogenesis of severe inflammatory responses	ELISA	24712905	2014	Pubchem_assay
PRRID_1656	tripalmitoyl-S-glycerol cysteine (Pam3Cys) Click for more detail	Bacteria	CCCCCCCCCCCCCCCC(=O)NC(CSCC(COC(=O)CCCCCCCCCCCCCCC)OC(=O)CCCCCCCCCCCCCCC)C(=O)O	NA	Lipopeptides	Synthetic	provide immunostimulatory activity	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	C57BL/6J mice	monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells	Toll/IL-1R (TIR) domain-containing adaptor molecule MyD88 (myeloid differentiation factor 88)-dependent pathway	Q9QUN7.fasta	Q9QUN7	784	significant role in the pathogenesis of severe inflammatory responses	ELISA	24712905	2014	Pubchem_assay
PRRID_1657	type I interferons Click for more detail	Host (Endogenous) (others)	MYTVQSWTCICLIICSMQSVCHCCDWIRHHYGHLSSEYLSLLDQMGGDITKQDAPVFFPTSLYRHIDDAEVEDQVRFLKETIYQITKLFDGNMKSVTWDKKKLDDFLNILERQLENLKSCVSPAMKPEKRLKRYFKKLNKNVLRKMNYSAQAWELIRKETKRHLQRLDILAAQMY	175	Protein	Natural	induces TLR7 and TLR 8 in salmon	Toll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Atlantic salmon (Salmo salar)	highest expression in spleen and head kidney and relatively low expression in muscle, liver, gut, heart and gill	NA	S0F0X6.fasta	S0F0X6	1063	antiviral response in salmon	Real-time PCR	24736205	2014	Pubchem_assay
PRRID_1657	type I interferons Click for more detail	Host (Endogenous) (others)	MYTVQSWTCICLIICSMQSVCHCCDWIRHHYGHLSSEYLSLLDQMGGDITKQDAPVFFPTSLYRHIDDAEVEDQVRFLKETIYQITKLFDGNMKSVTWDKKKLDDFLNILERQLENLKSCVSPAMKPEKRLKRYFKKLNKNVLRKMNYSAQAWELIRKETKRHLQRLDILAAQMY	175	Protein	Natural	induces TLR7 and TLR 8 in salmon	Toll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Atlantic salmon (Salmo salar)	highest expression in spleen and head kidney and relatively low expression in muscle, liver, gut, heart and gill	NA	S0F0X6.fasta	S0F0X6	1063	antiviral response in salmon	Real-time PCR	24736205	2014	Pubchem_assay
PRRID_1658	type I interferons Click for more detail	Host (Endogenous) (others)	MYTVQSWTCICLIICSMQSVCHCCDWIRHHYGHLSSEYLSLLDQMGGDITKQDAPVFFPTSLYRHIDDAEVEDQVRFLKETIYQITKLFDGNMKSVTWDKKKLDDFLNILERQLENLKSCVSPAMKPEKRLKRYFKKLNKNVLRKMNYSAQAWELIRKETKRHLQRLDILAAQMY	175	Protein	Natural	induces TLR7 and TLR 8 in salmon	Toll-like receptor 8a1 (TLR8a1)	Toll-like receptor (TLR)	Atlantic salmon (Salmo salar)	highest expression in spleen and head kidney and relatively low expression in muscle, liver, gut, heart and gill	NA	NA	NA	NA	antiviral response in salmon	Real-time PCR	24736205	2014	NA
PRRID_1658	type I interferons Click for more detail	Host (Endogenous) (others)	MYTVQSWTCICLIICSMQSVCHCCDWIRHHYGHLSSEYLSLLDQMGGDITKQDAPVFFPTSLYRHIDDAEVEDQVRFLKETIYQITKLFDGNMKSVTWDKKKLDDFLNILERQLENLKSCVSPAMKPEKRLKRYFKKLNKNVLRKMNYSAQAWELIRKETKRHLQRLDILAAQMY	175	Protein	Natural	induces TLR7 and TLR 8 in salmon	Toll-like receptor 8a1 (TLR8a1)	Toll-like receptor (TLR)	Atlantic salmon (Salmo salar)	highest expression in spleen and head kidney and relatively low expression in muscle, liver, gut, heart and gill	NA	NA	NA	NA	antiviral response in salmon	Real-time PCR	24736205	2014	NA
PRRID_1659	type I interferons Click for more detail	Host (Endogenous) (others)	MYTVQSWTCICLIICSMQSVCHCCDWIRHHYGHLSSEYLSLLDQMGGDITKQDAPVFFPTSLYRHIDDAEVEDQVRFLKETIYQITKLFDGNMKSVTWDKKKLDDFLNILERQLENLKSCVSPAMKPEKRLKRYFKKLNKNVLRKMNYSAQAWELIRKETKRHLQRLDILAAQMY	175	Protein	Natural	induces TLR7 and TLR 8 in salmon	Toll-like receptor 8a2 (TLR8a2)	Toll-like receptor (TLR)	Atlantic salmon (Salmo salar)	highest expression in spleen and head kidney and relatively low expression in muscle, liver, gut, heart and gill	NA	S0F0N4.fasta	S0F0N4	1035	antiviral response in salmon	Real-time PCR	24736205	2014	Pubchem_assay
PRRID_1659	type I interferons Click for more detail	Host (Endogenous) (others)	MYTVQSWTCICLIICSMQSVCHCCDWIRHHYGHLSSEYLSLLDQMGGDITKQDAPVFFPTSLYRHIDDAEVEDQVRFLKETIYQITKLFDGNMKSVTWDKKKLDDFLNILERQLENLKSCVSPAMKPEKRLKRYFKKLNKNVLRKMNYSAQAWELIRKETKRHLQRLDILAAQMY	175	Protein	Natural	induces TLR7 and TLR 8 in salmon	Toll-like receptor 8a2 (TLR8a2)	Toll-like receptor (TLR)	Atlantic salmon (Salmo salar)	highest expression in spleen and head kidney and relatively low expression in muscle, liver, gut, heart and gill	NA	S0F0N4.fasta	S0F0N4	1035	antiviral response in salmon	Real-time PCR	24736205	2014	Pubchem_assay
PRRID_1660	type I interferons Click for more detail	Host (Endogenous) (others)	MYTVQSWTCICLIICSMQSVCHCCDWIRHHYGHLSSEYLSLLDQMGGDITKQDAPVFFPTSLYRHIDDAEVEDQVRFLKETIYQITKLFDGNMKSVTWDKKKLDDFLNILERQLENLKSCVSPAMKPEKRLKRYFKKLNKNVLRKMNYSAQAWELIRKETKRHLQRLDILAAQMY	175	Protein	Natural	induces TLR7 and TLR 8 in salmon	Toll-like receptor 8b1 (TLR8b1)	Toll-like receptor (TLR)	Atlantic salmon (Salmo salar)	highest expression in spleen and head kidney and relatively low expression in muscle, liver, gut, heart and gill	NA	S0F1A6.fasta	S0F1A6	1034	antiviral response in salmon	Real-time PCR	24736205	2014	Pubchem_assay
PRRID_1660	type I interferons Click for more detail	Host (Endogenous) (others)	MYTVQSWTCICLIICSMQSVCHCCDWIRHHYGHLSSEYLSLLDQMGGDITKQDAPVFFPTSLYRHIDDAEVEDQVRFLKETIYQITKLFDGNMKSVTWDKKKLDDFLNILERQLENLKSCVSPAMKPEKRLKRYFKKLNKNVLRKMNYSAQAWELIRKETKRHLQRLDILAAQMY	175	Protein	Natural	induces TLR7 and TLR 8 in salmon	Toll-like receptor 8b1 (TLR8b1)	Toll-like receptor (TLR)	Atlantic salmon (Salmo salar)	highest expression in spleen and head kidney and relatively low expression in muscle, liver, gut, heart and gill	NA	S0F1A6.fasta	S0F1A6	1034	antiviral response in salmon	Real-time PCR	24736205	2014	Pubchem_assay
PRRID_1661	type I interferons Click for more detail	Host (Endogenous) (others)	MYTVQSWTCICLIICSMQSVCHCCDWIRHHYGHLSSEYLSLLDQMGGDITKQDAPVFFPTSLYRHIDDAEVEDQVRFLKETIYQITKLFDGNMKSVTWDKKKLDDFLNILERQLENLKSCVSPAMKPEKRLKRYFKKLNKNVLRKMNYSAQAWELIRKETKRHLQRLDILAAQMY	175	Protein	Natural	induces TLR7 and TLR 8 in salmon	Toll-like receptor 8b2 (TLR8b2)	Toll-like receptor (TLR)	Atlantic salmon (Salmo salar)	highest expression in spleen and head kidney and relatively low expression in muscle, liver, gut, heart and gill	NA	S0F1D1.fasta	S0F1D1	1036	antiviral response in salmon	Real-time PCR	24736205	2014	Pubchem_assay
PRRID_1661	type I interferons Click for more detail	Host (Endogenous) (others)	MYTVQSWTCICLIICSMQSVCHCCDWIRHHYGHLSSEYLSLLDQMGGDITKQDAPVFFPTSLYRHIDDAEVEDQVRFLKETIYQITKLFDGNMKSVTWDKKKLDDFLNILERQLENLKSCVSPAMKPEKRLKRYFKKLNKNVLRKMNYSAQAWELIRKETKRHLQRLDILAAQMY	175	Protein	Natural	induces TLR7 and TLR 8 in salmon	Toll-like receptor 8b2 (TLR8b2)	Toll-like receptor (TLR)	Atlantic salmon (Salmo salar)	highest expression in spleen and head kidney and relatively low expression in muscle, liver, gut, heart and gill	NA	S0F1D1.fasta	S0F1D1	1036	antiviral response in salmon	Real-time PCR	24736205	2014	Pubchem_assay
PRRID_1662	Unmethylated CpG DNA Click for more detail	Bacteria	NA	NA	Nucleic Acid	Synthetic	act as immuno stimulants	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Mice	monocyte/macrophages, plasmacytoid DCs and B-lymphocytes	Cell Compartment/Intracellular (Endosome)	Q9NR96.fasta	Q9NR96	1032	induces pro-inflammatory cytokine response	NA	24830024	2014	Pubchem_assay
PRRID_1662	Unmethylated CpG DNA Click for more detail	Bacteria	NA	NA	Nucleic Acid	Synthetic	act as immuno stimulants	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Mice	monocyte/macrophages, plasmacytoid DCs and B-lymphocytes	Cell Compartment/Intracellular (Endosome)	Q9NR96.fasta	Q9NR96	1032	induces pro-inflammatory cytokine response	NA	24830024	2014	Pubchem_assay
PRRID_1663	Unmethylated CpG DNA Click for more detail	Apoptotic cell(Bacteria)	NA	NA	Nucleic Acid	Synthetic	act as immuno stimulants	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Mice	monocyte/macrophages, plasmacytoid DCs and B-lymphocytes	Cell Compartment/Intracellular (Endosome)	Q9NR96.fasta	Q9NR96	1032	TLR9 plays a crucial role in breaking tolerance and developing autoimmunity	ELISPOT assay, Proliferation assay	24828435	2014	Pubchem_assay
PRRID_1663	Unmethylated CpG DNA Click for more detail	Apoptotic cell(Bacteria)	NA	NA	Nucleic Acid	Synthetic	act as immuno stimulants	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Mice	monocyte/macrophages, plasmacytoid DCs and B-lymphocytes	Cell Compartment/Intracellular (Endosome)	Q9NR96.fasta	Q9NR96	1032	TLR9 plays a crucial role in breaking tolerance and developing autoimmunity	ELISPOT assay, Proliferation assay	24828435	2014	Pubchem_assay
PRRID_1664	Unmethylated CpG DNA Click for more detail	Apoptotic cell(Bacteria)	NA	NA	Nucleic Acid	Synthetic	act as immuno stimulants	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Human	monocyte/macrophages, plasmacytoid DCs and B-lymphocytes	Cell Compartment/Intracellular (Endosome)	Q9NR96.fasta	Q9NR96	1032	TLR9 plays a crucial role in breaking tolerance and developing autoimmunity	ELISPOT assay, Proliferation assay	24828435	2014	Pubchem_assay
PRRID_1664	Unmethylated CpG DNA Click for more detail	Apoptotic cell(Bacteria)	NA	NA	Nucleic Acid	Synthetic	act as immuno stimulants	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Human	monocyte/macrophages, plasmacytoid DCs and B-lymphocytes	Cell Compartment/Intracellular (Endosome)	Q9NR96.fasta	Q9NR96	1032	TLR9 plays a crucial role in breaking tolerance and developing autoimmunity	ELISPOT assay, Proliferation assay	24828435	2014	Pubchem_assay
PRRID_1665	Unmethylated CpG DNA Click for more detail	Bacteria	NA	NA	Nucleic Acid	Synthetic	act as immuno stimulants	Toll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Mice (Murine)	Plasmacytoid dendritic cells (pDCs) within endosomal compartments	intracellular receptors	P58681.fasta	P58681	1050	important role in the immune response to viral infection	flow cytometry analysis, Immunofluorescence, Quantitative polymerase chain reaction (qPCR), enzyme-linked immunosorbent assay (ELISA	24814238	2014	Pubchem_assay
PRRID_1665	Unmethylated CpG DNA Click for more detail	Bacteria	NA	NA	Nucleic Acid	Synthetic	act as immuno stimulants	Toll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Mice (Murine)	Plasmacytoid dendritic cells (pDCs) within endosomal compartments	intracellular receptors	P58681.fasta	P58681	1050	important role in the immune response to viral infection	flow cytometry analysis, Immunofluorescence, Quantitative polymerase chain reaction (qPCR), enzyme-linked immunosorbent assay (ELISA	24814238	2014	Pubchem_assay
PRRID_1666	Unmethylated CpG DNA Click for more detail	Bacteria	NA	NA	Nucleic Acid	Synthetic	act as immuno stimulants	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Mice (Murine)	Plasmacytoid dendritic cells (pDCs) within endosomal compartments	intracellular receptors	Q9NR96.fasta	Q9NR96	1032	important role in the immune response to viral infection	flow cytometry analysis, Immunofluorescence, Quantitative polymerase chain reaction (qPCR), enzyme-linked immunosorbent assay (ELISA	24814238	2014	Pubchem_assay
PRRID_1666	Unmethylated CpG DNA Click for more detail	Bacteria	NA	NA	Nucleic Acid	Synthetic	act as immuno stimulants	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Mice (Murine)	Plasmacytoid dendritic cells (pDCs) within endosomal compartments	intracellular receptors	Q9NR96.fasta	Q9NR96	1032	important role in the immune response to viral infection	flow cytometry analysis, Immunofluorescence, Quantitative polymerase chain reaction (qPCR), enzyme-linked immunosorbent assay (ELISA	24814238	2014	Pubchem_assay
PRRID_1667	Unmethylated CpG DNA Click for more detail	Bacteria	NA	NA	Nucleic Acid	Synthetic	act as immuno stimulants	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Mice	monocyte/macrophages, plasmacytoid DCs and B-lymphocytes	cell compartment	Q9NR96.fasta	Q9NR96	1032	Possible effect in case of stroke i.e it is Involved in preconditioning and No protection after gene knockout following cerebral ischemia	NA	24807166	2014	Pubchem_assay
PRRID_1667	Unmethylated CpG DNA Click for more detail	Bacteria	NA	NA	Nucleic Acid	Synthetic	act as immuno stimulants	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Mice	monocyte/macrophages, plasmacytoid DCs and B-lymphocytes	cell compartment	Q9NR96.fasta	Q9NR96	1032	Possible effect in case of stroke i.e it is Involved in preconditioning and No protection after gene knockout following cerebral ischemia	NA	24807166	2014	Pubchem_assay
PRRID_1668	Unmethylated CpG DNA Click for more detail	Bacteria	NA	NA	Nucleic Acid	Synthetic	act as immuno stimulants	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Human	monocyte/macrophages, plasmacytoid DCs and B-lymphocytes	cell compartment	Q9NR96.fasta	Q9NR96	1032	Possible effect in case of stroke i.e it is Involved in preconditioning and No protection after gene knockout following cerebral ischemia	NA	24807166	2014	Pubchem_assay
PRRID_1668	Unmethylated CpG DNA Click for more detail	Bacteria	NA	NA	Nucleic Acid	Synthetic	act as immuno stimulants	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Human	monocyte/macrophages, plasmacytoid DCs and B-lymphocytes	cell compartment	Q9NR96.fasta	Q9NR96	1032	Possible effect in case of stroke i.e it is Involved in preconditioning and No protection after gene knockout following cerebral ischemia	NA	24807166	2014	Pubchem_assay
PRRID_1669	Unmethylated CpG DNA Click for more detail	Bacteria	NA	NA	Nucleic Acid	Natural	act as adjuvants in vaccination strategies	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	C57BL/6 Mice	pDCs, macrophages	Cell Compartment/Intracellular (phagosomal compartment)	Q9NR96.fasta	Q9NR96	1032	induces pro-inflammatory cytokine response	NA	24801628	2014	Pubchem_assay
PRRID_1669	Unmethylated CpG DNA Click for more detail	Bacteria	NA	NA	Nucleic Acid	Natural	act as adjuvants in vaccination strategies	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	C57BL/6 Mice	pDCs, macrophages	Cell Compartment/Intracellular (phagosomal compartment)	Q9NR96.fasta	Q9NR96	1032	induces pro-inflammatory cytokine response	NA	24801628	2014	Pubchem_assay
PRRID_1670	Unmethylated CpG DNA Click for more detail	Bacteria	NA	NA	Nucleic Acid	Natural	triggers immune responses	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Male BALB/c mice	Myeloid-derived suppressor cells (MDSCs)	Intracellular receptors	Q9NR96.fasta	Q9NR96	1032	TLR9 plays a crucial role in breaking tolerance and developing autoimmunity	Functional assay	24748512	2014	Pubchem_assay
PRRID_1670	Unmethylated CpG DNA Click for more detail	Bacteria	NA	NA	Nucleic Acid	Natural	triggers immune responses	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Male BALB/c mice	Myeloid-derived suppressor cells (MDSCs)	Intracellular receptors	Q9NR96.fasta	Q9NR96	1032	TLR9 plays a crucial role in breaking tolerance and developing autoimmunity	Functional assay	24748512	2014	Pubchem_assay
PRRID_1671	Uric acid Click for more detail	Host (Endogenous) (others)	C12=C(NC(=O)N1)NC(=O)NC2=O	NA	Damage-associated molecular patterns (DAMPs)	Natural	Uric acid is a product of the metabolic breakdown of purine nucleotides, and it is a normal component of urine	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Mice	Keratinocytes and mouse skin	cell surface	Q9QUK6.fasta	Q9QUK6	835	play a role in UVB induced immune suppression	NA	24786223	2014	Pubchem_assay
PRRID_1671	Uric acid Click for more detail	Host (Endogenous) (others)	C12=C(NC(=O)N1)NC(=O)NC2=O	NA	Damage-associated molecular patterns (DAMPs)	Natural	Uric acid is a product of the metabolic breakdown of purine nucleotides, and it is a normal component of urine	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Mice	Keratinocytes and mouse skin	cell surface	Q9QUK6.fasta	Q9QUK6	835	play a role in UVB induced immune suppression	NA	24786223	2014	Pubchem_assay
PRRID_1672	Uric acid Click for more detail	Host (Endogenous) (others)	C12=C(NC(=O)N1)NC(=O)NC2=O	NA	Damage-associated molecular patterns (DAMPs)	Natural	Uric acid is a product of the metabolic breakdown of purine nucleotides, and it is a normal component of urine	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Human	Keratinocytes and mouse skin	cell surface	O00206.fasta	O00206	839	play a role in UVB induced immune suppression	NA	24786223	2014	Pubchem_assay
PRRID_1672	Uric acid Click for more detail	Host (Endogenous) (others)	C12=C(NC(=O)N1)NC(=O)NC2=O	NA	Damage-associated molecular patterns (DAMPs)	Natural	Uric acid is a product of the metabolic breakdown of purine nucleotides, and it is a normal component of urine	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Human	Keratinocytes and mouse skin	cell surface	O00206.fasta	O00206	839	play a role in UVB induced immune suppression	NA	24786223	2014	Pubchem_assay
PRRID_1673	Uropathogenic E. coli Click for more detail	Bacteria	NA	NA	Pattern-associated molecular patterns (PAMPs)	Natural	elicit innate immune response	Toll-like receptor 10 (TLR10)	Toll-like receptor (TLR)	Mice	monocyte/macrophages	Cell Surface (Exogenous)	Q6R5P0.fasta	Q6R5P0	926	TLR11 plays a fundamental role in both the innate and adaptive immune responses, through the activation of Tumor necrosis factor-alpha,the Interleukin 12 (IL-12) response and Interferon-gamma (IFN-gamma) secretion.	NA	24830024	2014	Pubchem_assay
PRRID_1673	Uropathogenic E. coli Click for more detail	Bacteria	NA	NA	Pattern-associated molecular patterns (PAMPs)	Natural	elicit innate immune response	Toll-like receptor 10 (TLR10)	Toll-like receptor (TLR)	Mice	monocyte/macrophages	Cell Surface (Exogenous)	Q6R5P0.fasta	Q6R5P0	926	TLR11 plays a fundamental role in both the innate and adaptive immune responses, through the activation of Tumor necrosis factor-alpha,the Interleukin 12 (IL-12) response and Interferon-gamma (IFN-gamma) secretion.	NA	24830024	2014	Pubchem_assay
PRRID_1674	VTX-2337 Click for more detail	mimics viral single-stranded ribonucleic acid (ssRNA) (virus)	CCCN(CCC)C(=O)C1=CC2=C(C=C(C=C2)C3=CC=C(C=C3)C(=O)N4CCCC4)N=C(C1)N	NA	Pattern-associated molecular patterns (PAMPs)	Natural	stimulates TLR8	Toll-like receptor 8 (TLR8)	Toll-like receptor (TLR)	Mice (Murine)	TLR8 is expressed on mDCs, monocytes, and NK cells in humans	cell compartment	P58682.fasta	P58682	1032	TLR8 is expected to stimulate the release of distinct inflammatory mediators, including Th1- polarizing cytokines, chemokines, and other acute phase proteins	NA	24807889	2014	Pubchem_assay
PRRID_1674	VTX-2337 Click for more detail	mimics viral single-stranded ribonucleic acid (ssRNA) (virus)	CCCN(CCC)C(=O)C1=CC2=C(C=C(C=C2)C3=CC=C(C=C3)C(=O)N4CCCC4)N=C(C1)N	NA	Pattern-associated molecular patterns (PAMPs)	Natural	stimulates TLR8	Toll-like receptor 8 (TLR8)	Toll-like receptor (TLR)	Mice (Murine)	TLR8 is expressed on mDCs, monocytes, and NK cells in humans	cell compartment	P58682.fasta	P58682	1032	TLR8 is expected to stimulate the release of distinct inflammatory mediators, including Th1- polarizing cytokines, chemokines, and other acute phase proteins	NA	24807889	2014	Pubchem_assay
PRRID_1675	VTX-2337 Click for more detail	mimics viral single-stranded ribonucleic acid (ssRNA) (virus)	CCCN(CCC)C(=O)C1=CC2=C(C=C(C=C2)C3=CC=C(C=C3)C(=O)N4CCCC4)N=C(C1)N	NA	Pattern-associated molecular patterns (PAMPs)	Natural	stimulates TLR8	Toll-like receptor 8 (TLR8)	Toll-like receptor (TLR)	Human	TLR8 is expressed on mDCs, monocytes, and NK cells in humans	cell compartment	Q9NR97.fasta	Q9NR97	1041	TLR8 is expected to stimulate the release of distinct inflammatory mediators, including Th1- polarizing cytokines, chemokines, and other acute phase proteins	NA	24807889	2014	Pubchem_assay
PRRID_1675	VTX-2337 Click for more detail	mimics viral single-stranded ribonucleic acid (ssRNA) (virus)	CCCN(CCC)C(=O)C1=CC2=C(C=C(C=C2)C3=CC=C(C=C3)C(=O)N4CCCC4)N=C(C1)N	NA	Pattern-associated molecular patterns (PAMPs)	Natural	stimulates TLR8	Toll-like receptor 8 (TLR8)	Toll-like receptor (TLR)	Human	TLR8 is expressed on mDCs, monocytes, and NK cells in humans	cell compartment	Q9NR97.fasta	Q9NR97	1041	TLR8 is expected to stimulate the release of distinct inflammatory mediators, including Th1- polarizing cytokines, chemokines, and other acute phase proteins	NA	24807889	2014	Pubchem_assay
PRRID_1676	Zymosan Click for more detail	S. cerevisiae (Bacteria)	C(C1C(C(C(C(O1)O)O)O)O)O	NA	Glucan	Natural	activates macrophages via TLR2.	Toll-like receptor 2 (TLR2)/Toll-like receptor 6 (TLR6)	Toll-like receptor (TLR)	Human	monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells	Cell Surface (Exogenous)	NA	NA	NA	TLR2 cooperates with TLR6 and CD14 in response to zymosan	NA	24830024	2014	NA
PRRID_1676	Zymosan Click for more detail	S. cerevisiae (Bacteria)	C(C1C(C(C(C(O1)O)O)O)O)O	NA	Glucan	Natural	activates macrophages via TLR2.	Toll-like receptor 2 (TLR2)/Toll-like receptor 6 (TLR6)	Toll-like receptor (TLR)	Human	monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells	Cell Surface (Exogenous)	NA	NA	NA	TLR2 cooperates with TLR6 and CD14 in response to zymosan	NA	24830024	2014	NA
PRRID_1677	Zymosan Click for more detail	S. cerevisiae (Bacteria)	C(C1C(C(C(C(O1)O)O)O)O)O	NA	Glucan	Natural	activates macrophages via TLR2.	Toll-like receptor 2 (TLR2)/Toll-like receptor 6 (TLR6)	Toll-like receptor (TLR)	Mice	monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells	Cell Surface (Exogenous)	NA	NA	NA	TLR2 cooperates with TLR6 and CD14 in response to zymosan	NA	24830024	2014	NA
PRRID_1677	Zymosan Click for more detail	S. cerevisiae (Bacteria)	C(C1C(C(C(C(O1)O)O)O)O)O	NA	Glucan	Natural	activates macrophages via TLR2.	Toll-like receptor 2 (TLR2)/Toll-like receptor 6 (TLR6)	Toll-like receptor (TLR)	Mice	monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells	Cell Surface (Exogenous)	NA	NA	NA	TLR2 cooperates with TLR6 and CD14 in response to zymosan	NA	24830024	2014	NA
PRRID_1678	Zymosan Click for more detail	S. cerevisiae (Bacteria)	C(C1C(C(C(C(O1)O)O)O)O)O	NA	Glucan	Natural	induction of proinflammatory cytokines	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	mast cells	cell surface	O60603.fasta	O60603	784	significant role in the pathogenesis of severe inflammatory responses	Real-time PCR	24818634	2014	Pubchem_assay
PRRID_1678	Zymosan Click for more detail	S. cerevisiae (Bacteria)	C(C1C(C(C(C(O1)O)O)O)O)O	NA	Glucan	Natural	induction of proinflammatory cytokines	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	mast cells	cell surface	O60603.fasta	O60603	784	significant role in the pathogenesis of severe inflammatory responses	Real-time PCR	24818634	2014	Pubchem_assay
PRRID_1679	Zymosan Click for more detail	Fungi	C(C1C(C(C(C(O1)O)O)O)O)O	NA	Glucan	Natural	induction of proinflammatory cytokines	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice	monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells	cell surface	Q9QUN7.fasta	Q9QUN7	784	Possible effect in case of stroke i.e Up-regulation of TLR2 mRNA correlates with severity of ischemia	NA	24807166	2014	Pubchem_assay
PRRID_1679	Zymosan Click for more detail	Fungi	C(C1C(C(C(C(O1)O)O)O)O)O	NA	Glucan	Natural	induction of proinflammatory cytokines	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice	monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells	cell surface	Q9QUN7.fasta	Q9QUN7	784	Possible effect in case of stroke i.e Up-regulation of TLR2 mRNA correlates with severity of ischemia	NA	24807166	2014	Pubchem_assay
PRRID_1680	Zymosan Click for more detail	Fungi	C(C1C(C(C(C(O1)O)O)O)O)O	NA	Glucan	Natural	induction of proinflammatory cytokines	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells	cell surface	O60603.fasta	O60603	784	Possible effect in case of stroke i.e Up-regulation of TLR2 mRNA correlates with severity of ischemia	NA	24807166	2014	Pubchem_assay
PRRID_1680	Zymosan Click for more detail	Fungi	C(C1C(C(C(C(O1)O)O)O)O)O	NA	Glucan	Natural	induction of proinflammatory cytokines	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells	cell surface	O60603.fasta	O60603	784	Possible effect in case of stroke i.e Up-regulation of TLR2 mRNA correlates with severity of ischemia	NA	24807166	2014	Pubchem_assay
PRRID_1681	Zymosan Click for more detail	Fungi	C(C1C(C(C(C(O1)O)O)O)O)O	NA	Glucan	Natural	induction of proinflammatory cytokines	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice	human MSCs (hMSCs) and murine MSCs (mMSCs)	cell surface	Q9QUN7.fasta	Q9QUN7	784	TLR2 cooperates with TLR6 and CD14 in response to zymosan	NA	24780395	2014	Pubchem_assay
PRRID_1681	Zymosan Click for more detail	Fungi	C(C1C(C(C(C(O1)O)O)O)O)O	NA	Glucan	Natural	induction of proinflammatory cytokines	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice	human MSCs (hMSCs) and murine MSCs (mMSCs)	cell surface	Q9QUN7.fasta	Q9QUN7	784	TLR2 cooperates with TLR6 and CD14 in response to zymosan	NA	24780395	2014	Pubchem_assay
PRRID_1682	Zymosan Click for more detail	Fungi	C(C1C(C(C(C(O1)O)O)O)O)O	NA	Glucan	Natural	induction of proinflammatory cytokines	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	human MSCs (hMSCs) and murine MSCs (mMSCs)	cell surface	O60603.fasta	O60603	784	TLR2 cooperates with TLR6 and CD14 in response to zymosan	NA	24780395	2014	Pubchem_assay
PRRID_1682	Zymosan Click for more detail	Fungi	C(C1C(C(C(C(O1)O)O)O)O)O	NA	Glucan	Natural	induction of proinflammatory cytokines	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	human MSCs (hMSCs) and murine MSCs (mMSCs)	cell surface	O60603.fasta	O60603	784	TLR2 cooperates with TLR6 and CD14 in response to zymosan	NA	24780395	2014	Pubchem_assay
PRRID_1683	Zymosan Click for more detail	Fungi(Yeast)	C(C1C(C(C(C(O1)O)O)O)O)O	NA	Glucan	Natural	induction of proinflammatory cytokines	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice	monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells	extracellular domain with leucine-rich repeats and a conservative intracellular Toll/IL- 1 receptor (TIR) domain	Q9QUN7.fasta	Q9QUN7	784	significant role in the pathogenesis of severe inflammatory responses	ELISA	24757287	2014	Pubchem_assay
PRRID_1683	Zymosan Click for more detail	Fungi(Yeast)	C(C1C(C(C(C(O1)O)O)O)O)O	NA	Glucan	Natural	induction of proinflammatory cytokines	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice	monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells	extracellular domain with leucine-rich repeats and a conservative intracellular Toll/IL- 1 receptor (TIR) domain	Q9QUN7.fasta	Q9QUN7	784	significant role in the pathogenesis of severe inflammatory responses	ELISA	24757287	2014	Pubchem_assay
PRRID_1684	Zymosan Click for more detail	Fungi(Yeast)	C(C1C(C(C(C(O1)O)O)O)O)O	NA	Glucan	Natural	induction of proinflammatory cytokines	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells	extracellular domain with leucine-rich repeats and a conservative intracellular Toll/IL- 1 receptor (TIR) domain	O60603.fasta	O60603	784	significant role in the pathogenesis of severe inflammatory responses	ELISA	24757287	2014	Pubchem_assay
PRRID_1684	Zymosan Click for more detail	Fungi(Yeast)	C(C1C(C(C(C(O1)O)O)O)O)O	NA	Glucan	Natural	induction of proinflammatory cytokines	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells	extracellular domain with leucine-rich repeats and a conservative intracellular Toll/IL- 1 receptor (TIR) domain	O60603.fasta	O60603	784	significant role in the pathogenesis of severe inflammatory responses	ELISA	24757287	2014	Pubchem_assay
PRRID_1685	Zymosan Click for more detail	Fungi(Yeast)	C(C1C(C(C(C(O1)O)O)O)O)O	NA	Glucan	Natural	induction of proinflammatory cytokines	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice	monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells	extracellular domains of leucine-rich repeat motifs	Q9QUN7.fasta	Q9QUN7	784	significant role in the pathogenesis of severe inflammatory responses	NA	24754320	2014	Pubchem_assay
PRRID_1685	Zymosan Click for more detail	Fungi(Yeast)	C(C1C(C(C(C(O1)O)O)O)O)O	NA	Glucan	Natural	induction of proinflammatory cytokines	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice	monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells	extracellular domains of leucine-rich repeat motifs	Q9QUN7.fasta	Q9QUN7	784	significant role in the pathogenesis of severe inflammatory responses	NA	24754320	2014	Pubchem_assay
PRRID_1686	Zymosan Click for more detail	Fungi(Yeast)	C(C1C(C(C(C(O1)O)O)O)O)O	NA	Glucan	Natural	induction of proinflammatory cytokines	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells	extracellular domains of leucine-rich repeat motifs	O60603.fasta	O60603	784	significant role in the pathogenesis of severe inflammatory responses	NA	24754320	2014	Pubchem_assay
PRRID_1686	Zymosan Click for more detail	Fungi(Yeast)	C(C1C(C(C(C(O1)O)O)O)O)O	NA	Glucan	Natural	induction of proinflammatory cytokines	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells	extracellular domains of leucine-rich repeat motifs	O60603.fasta	O60603	784	significant role in the pathogenesis of severe inflammatory responses	NA	24754320	2014	Pubchem_assay
PRRID_1693	CpG-ODN 1826 Click for more detail	NA	5‚Äô-tccatgacgttcctgacgtt-3‚Äô	20	Nucleic Acid	Synthetic	TLR9 stimulation induces apoptosis of neurons via SARM1 signalling pathway	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Mice	Primary cortical neurons	NA	Q9NR96.fasta	Q9NR96	1032	It resulted in neuronal apoptosis in primary cortical neuronal cultures and olfactory sensory neurons.	MTT assay	26423149	2015	Pubchem_assay
PRRID_1693	CpG-ODN 1826 Click for more detail	NA	5‚Äô-tccatgacgttcctgacgtt-3‚Äô	20	Nucleic Acid	Synthetic	TLR9 stimulation induces apoptosis of neurons via SARM1 signalling pathway	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Mice	Primary cortical neurons	NA	Q9NR96.fasta	Q9NR96	1032	It resulted in neuronal apoptosis in primary cortical neuronal cultures and olfactory sensory neurons.	MTT assay	26423149	2015	Pubchem_assay
PRRID_1696	Imiquimod Click for more detail	NA	CC(C)CN1C=NC2=C1C3=CC=CC=C3N=C2N	NA	Nucleic Acid	Synthetic	TLR7 stimulation induces apoptosis of neurons via SARM1 signalling pathway	Toll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Mice	Primary cortical neurons	NA	P58681.fasta	P58681	1050	It resulted in neuronal apoptosis in primary cortical neuronal cultures and olfactory sensory neurons.	MTT assay	26423149	2015	Pubchem_assay
PRRID_1696	Imiquimod Click for more detail	NA	CC(C)CN1C=NC2=C1C3=CC=CC=C3N=C2N	NA	Nucleic Acid	Synthetic	TLR7 stimulation induces apoptosis of neurons via SARM1 signalling pathway	Toll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Mice	Primary cortical neurons	NA	P58681.fasta	P58681	1050	It resulted in neuronal apoptosis in primary cortical neuronal cultures and olfactory sensory neurons.	MTT assay	26423149	2015	Pubchem_assay
PRRID_1702	Surface Layer Proteins (SLPs) Click for more detail	Clostridium difficile(Bacteria)	CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC	NA	Protein	Natural	The binding induces the production of IL-23 via MyD-88 signalling pathway.	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Mice (Murine)	Dendritic cells	LRR	Q9QUK6.fasta	Q9QUK6	835	It has the role in the inflammation.	ELISA	25626905	2015	Pubchem_assay
PRRID_1702	Surface Layer Proteins (SLPs) Click for more detail	Clostridium difficile(Bacteria)	CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC	NA	Protein	Natural	The binding induces the production of IL-23 via MyD-88 signalling pathway.	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Mice (Murine)	Dendritic cells	LRR	Q9QUK6.fasta	Q9QUK6	835	It has the role in the inflammation.	ELISA	25626905	2015	Pubchem_assay
PRRID_1703	Surface Layer Proteins (SLPs) Click for more detail	Clostridium difficile(Bacteria)	CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC	NA	Protein	Natural	The binding induces the production of IL-23 via MyD-88 signalling pathway.	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Human	Dendritic cells	LRR	O00206.fasta	O00206	839	It has the role in the inflammation.	ELISA	25626905	2015	Pubchem_assay
PRRID_1703	Surface Layer Proteins (SLPs) Click for more detail	Clostridium difficile(Bacteria)	CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC	NA	Protein	Natural	The binding induces the production of IL-23 via MyD-88 signalling pathway.	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Human	Dendritic cells	LRR	O00206.fasta	O00206	839	It has the role in the inflammation.	ELISA	25626905	2015	Pubchem_assay
PRRID_1704	NS1 protein Click for more detail	Dengue virus(virus)	DMGYWIESEKNETWKLARASFIEVKTCIWPKSHTLWSNGVLESEMIIPKIYGGPISQHNYRPGYFTQTAGPWHLGKLELDFDLCEGTTVVVDEHCGNRGPSLRTTTVTGKIIHEWCCRSCTLPPLRFKGEDGCWYGM	137	Pattern-associated molecular patterns (PAMPs)	Natural	Immunostimulant	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Human	NA	NA	O00206.fasta	O00206	839	NA	NA	27293318	2016	Pubchem_assay
PRRID_1704	NS1 protein Click for more detail	Dengue virus(virus)	DMGYWIESEKNETWKLARASFIEVKTCIWPKSHTLWSNGVLESEMIIPKIYGGPISQHNYRPGYFTQTAGPWHLGKLELDFDLCEGTTVVVDEHCGNRGPSLRTTTVTGKIIHEWCCRSCTLPPLRFKGEDGCWYGM	137	Pattern-associated molecular patterns (PAMPs)	Natural	Immunostimulant	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Human	NA	NA	O00206.fasta	O00206	839	NA	NA	27293318	2016	Pubchem_assay
PRRID_1705	NS1 protein Click for more detail	Dengue virus(virus)	DMGYWIESEKNETWKLARASFIEVKTCIWPKSHTLWSNGVLESEMIIPKIYGGPISQHNYRPGYFTQTAGPWHLGKLELDFDLCEGTTVVVDEHCGNRGPSLRTTTVTGKIIHEWCCRSCTLPPLRFKGEDGCWYGM	137	Pattern-associated molecular patterns (PAMPs)	Natural	Immunostimulant	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	NA	NA	NA	NA	NA	NA	Activate NF-Kb	NA	27293318	2016	NA
PRRID_1705	NS1 protein Click for more detail	Dengue virus(virus)	DMGYWIESEKNETWKLARASFIEVKTCIWPKSHTLWSNGVLESEMIIPKIYGGPISQHNYRPGYFTQTAGPWHLGKLELDFDLCEGTTVVVDEHCGNRGPSLRTTTVTGKIIHEWCCRSCTLPPLRFKGEDGCWYGM	137	Pattern-associated molecular patterns (PAMPs)	Natural	Immunostimulant	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	NA	NA	NA	NA	NA	NA	Activate NF-Kb	NA	27293318	2016	NA
PRRID_1706	19 kDa lipoprotein Click for more detail	Mycobacterium tuberculosis (Bacteria)	MKRGLTVAVAGAAILVAGLSGCSSNKSTTGSGETTTAAGTTASPGAASGPKVVIDGKDQNVTGSVVCTTAAGNVNIAIGGAATGIAAVLTDGNPPEVKSVGLGNVNGVTLGYTSGTGQGNASATKDGSHYKITGTATGVDMANPMSPVNKSFEIEVTCS	159	NA	Natural	Immunostimulant	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	NA	NA	NA	NA	NA	NA	Induces apoptosis and inhibits IFN- induced expression of several immune function genes	NA	26775799	2016	NA
PRRID_1706	19 kDa lipoprotein Click for more detail	Mycobacterium tuberculosis (Bacteria)	MKRGLTVAVAGAAILVAGLSGCSSNKSTTGSGETTTAAGTTASPGAASGPKVVIDGKDQNVTGSVVCTTAAGNVNIAIGGAATGIAAVLTDGNPPEVKSVGLGNVNGVTLGYTSGTGQGNASATKDGSHYKITGTATGVDMANPMSPVNKSFEIEVTCS	159	NA	Natural	Immunostimulant	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	NA	NA	NA	NA	NA	NA	Induces apoptosis and inhibits IFN- induced expression of several immune function genes	NA	26775799	2016	NA
PRRID_1707	3M-002 Click for more detail	NA	CCCC1=NC2=C(S1)C3=CC=CC=C3N=C2N	NA	Pattern-associated molecular patterns (PAMPs)	Natural	Immunostimulant	RDToll-like receptor 8 (TLR8)	Toll-like receptor (TLR)	Chinese raccoon dog	peripheral blood mononuclear cells (PBMCs)	19 leucine-rich repeats (LRRs) in the extracel- lular domain and a cytoplasmic TIR domain	NA	NA	NA	proinflammatory cytokines TNF- a and IFN-a upregulation	qRT-PCR	27481482	2016	NA
PRRID_1707	3M-002 Click for more detail	NA	CCCC1=NC2=C(S1)C3=CC=CC=C3N=C2N	NA	Pattern-associated molecular patterns (PAMPs)	Natural	Immunostimulant	RDToll-like receptor 8 (TLR8)	Toll-like receptor (TLR)	Chinese raccoon dog	peripheral blood mononuclear cells (PBMCs)	19 leucine-rich repeats (LRRs) in the extracel- lular domain and a cytoplasmic TIR domain	NA	NA	NA	proinflammatory cytokines TNF- a and IFN-a upregulation	qRT-PCR	27481482	2016	NA
PRRID_1708	Agonist Click for more detail	NA	NA	NA	Pattern-associated molecular patterns (PAMPs)	Natural	immunostimulant	Toll-like receptor 1/2 (TLR1/2)	Toll-like receptor (TLR)	Mice (Murine)	NA	NA	NA	NA	NA	Controversial (induce or inhibit)	NA	27120222	2016	NA
PRRID_1708	Agonist Click for more detail	NA	NA	NA	Pattern-associated molecular patterns (PAMPs)	Natural	immunostimulant	Toll-like receptor 1/2 (TLR1/2)	Toll-like receptor (TLR)	Mice (Murine)	NA	NA	NA	NA	NA	Controversial (induce or inhibit)	NA	27120222	2016	NA
PRRID_1709	Agonist Click for more detail	NA	NA	NA	Pattern-associated molecular patterns (PAMPs)	Natural	Immunostimulant	Toll-like receptor 3 (TLR3)	Toll-like receptor (TLR)	Mice (Murine)	NA	NA	Q99MB1.fasta	Q99MB1	905	Controversial (induce or inhibit)	NA	27120222	2016	Pubchem_assay
PRRID_1709	Agonist Click for more detail	NA	NA	NA	Pattern-associated molecular patterns (PAMPs)	Natural	Immunostimulant	Toll-like receptor 3 (TLR3)	Toll-like receptor (TLR)	Mice (Murine)	NA	NA	Q99MB1.fasta	Q99MB1	905	Controversial (induce or inhibit)	NA	27120222	2016	Pubchem_assay
PRRID_1710	Agonist Click for more detail	NA	NA	NA	Pattern-associated molecular patterns (PAMPs)	Natural	Immunostimulant	Toll-like receptor 2/6 (TLR2/6)	Toll-like receptor (TLR)	Mice (Murine)	NA	NA	NA	NA	NA	attenuates asthma	NA	27120222	2016	NA
PRRID_1710	Agonist Click for more detail	NA	NA	NA	Pattern-associated molecular patterns (PAMPs)	Natural	Immunostimulant	Toll-like receptor 2/6 (TLR2/6)	Toll-like receptor (TLR)	Mice (Murine)	NA	NA	NA	NA	NA	attenuates asthma	NA	27120222	2016	NA
PRRID_1711	Agonist Click for more detail	NA	NA	NA	Pattern-associated molecular patterns (PAMPs)	Natural	Immunostimulant	Toll-like receptor 7/8 (TLR7/8)	Toll-like receptor (TLR)	Mice (Murine)	NA	NA	NA	NA	NA	Attenuate or inhibit	NA	27120222	2016	NA
PRRID_1711	Agonist Click for more detail	NA	NA	NA	Pattern-associated molecular patterns (PAMPs)	Natural	Immunostimulant	Toll-like receptor 7/8 (TLR7/8)	Toll-like receptor (TLR)	Mice (Murine)	NA	NA	NA	NA	NA	Attenuate or inhibit	NA	27120222	2016	NA
PRRID_1712	Agonist Click for more detail	NA	NA	NA	Pattern-associated molecular patterns (PAMPs)	Natural	immunostimulant	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Mice (Murine)	NA	NA	Q9NR96.fasta	Q9NR96	1032	Attenuate or inhibit	NA	27120222	2016	Pubchem_assay
PRRID_1712	Agonist Click for more detail	NA	NA	NA	Pattern-associated molecular patterns (PAMPs)	Natural	immunostimulant	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Mice (Murine)	NA	NA	Q9NR96.fasta	Q9NR96	1032	Attenuate or inhibit	NA	27120222	2016	Pubchem_assay
PRRID_1713	Agonist Click for more detail	Helminths (others)	NA	NA	Pattern-associated molecular patterns (PAMPs)	Natural	Controversial (induce or inhibit)	Toll-like receptor 1/2 (TLR1/2)	Toll-like receptor (TLR)	Mice (Murine)	NA	NA	NA	NA	NA	Expansion of Tregs in OVA-induced asthma model	NA	27120222	2016	NA
PRRID_1713	Agonist Click for more detail	Helminths (others)	NA	NA	Pattern-associated molecular patterns (PAMPs)	Natural	Controversial (induce or inhibit)	Toll-like receptor 1/2 (TLR1/2)	Toll-like receptor (TLR)	Mice (Murine)	NA	NA	NA	NA	NA	Expansion of Tregs in OVA-induced asthma model	NA	27120222	2016	NA
PRRID_1714	Agonist Click for more detail	Helminths (others)	NA	NA	Pattern-associated molecular patterns (PAMPs)	Natural	Immunostimulant	Toll-like receptor 3 (TLR3)	Toll-like receptor (TLR)	Mice (Murine)	NA	NA	Q99MB1.fasta	Q99MB1	905	NFŒ∫B‚Üë	NA	27120222	2016	Pubchem_assay
PRRID_1714	Agonist Click for more detail	Helminths (others)	NA	NA	Pattern-associated molecular patterns (PAMPs)	Natural	Immunostimulant	Toll-like receptor 3 (TLR3)	Toll-like receptor (TLR)	Mice (Murine)	NA	NA	Q99MB1.fasta	Q99MB1	905	NFŒ∫B‚Üë	NA	27120222	2016	Pubchem_assay
PRRID_1715	Amyloid-Œ≤ fibrils Click for more detail	NA	MLPGLALLLLAAWTARALEVPTDGNAGLLAEPQIAMFCGRLNMHMNVQNGKWDSDPSGTKTCIDTKEGILQYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHPHFVIPYRCLVGEFVSDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFRGVEFVCCPLAEESDNVDSADAEEDDSDVWWGGADTDYADGSEDKVVEVAEEEEVAEVEEEEADDDEDDEDGDEVEEEAEEPYEEATERTTSIATTTTTTTESVEEVVREVCSEQAETGPCRAMISRWYFDVTEGKCAPFFYGGCGGNRNNFDTEEYCMAVCGSAMSQSLLKTTQEPLARDPVKLPTTAASTPDAVDKYLETPGDENEHAHFQKAKERLEAKHRERMSQVMREWEEAERQAKNLPKADKKAVIQHFQEKVESLEQEAANERQQLVETHMARVEAMLNDRRRLALENYITALQAVPPRPRHVFNMLKKYVRAEQKDRQHTLKHFEHVRMVDPKKAAQIRSQVMTHLRVIYERMNQSLSLLYNVPAVAEEIQDEVDELLQKEQNYSDDVLANMISEPRISYGNDALMPSLTETKTTVELLPVNGEFSLDDLQPWHSFGADSVPANTENEVEPVDARPAADRGLTTRPGSGLTNIKTEEISEVKMDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITLVMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN	770	Damage-associated molecular patterns (DAMPs)	Natural	Immunostimulant	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	NA	NA	NA	NA	NA	NA	Activate NF-Kb	NA	27293318	2016	NA
PRRID_1715	Amyloid-Œ≤ fibrils Click for more detail	NA	MLPGLALLLLAAWTARALEVPTDGNAGLLAEPQIAMFCGRLNMHMNVQNGKWDSDPSGTKTCIDTKEGILQYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHPHFVIPYRCLVGEFVSDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFRGVEFVCCPLAEESDNVDSADAEEDDSDVWWGGADTDYADGSEDKVVEVAEEEEVAEVEEEEADDDEDDEDGDEVEEEAEEPYEEATERTTSIATTTTTTTESVEEVVREVCSEQAETGPCRAMISRWYFDVTEGKCAPFFYGGCGGNRNNFDTEEYCMAVCGSAMSQSLLKTTQEPLARDPVKLPTTAASTPDAVDKYLETPGDENEHAHFQKAKERLEAKHRERMSQVMREWEEAERQAKNLPKADKKAVIQHFQEKVESLEQEAANERQQLVETHMARVEAMLNDRRRLALENYITALQAVPPRPRHVFNMLKKYVRAEQKDRQHTLKHFEHVRMVDPKKAAQIRSQVMTHLRVIYERMNQSLSLLYNVPAVAEEIQDEVDELLQKEQNYSDDVLANMISEPRISYGNDALMPSLTETKTTVELLPVNGEFSLDDLQPWHSFGADSVPANTENEVEPVDARPAADRGLTTRPGSGLTNIKTEEISEVKMDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITLVMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN	770	Damage-associated molecular patterns (DAMPs)	Natural	Immunostimulant	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	NA	NA	NA	NA	NA	NA	Activate NF-Kb	NA	27293318	2016	NA
PRRID_1717	Bacterial 23S ribosomal RNA Click for more detail	Bacteria	GGUUAAGCGACUAAGCGUACACGGUGGAUGCCCUGGCAGUCAGAGGCGAUGAAGGACGUGCUAAUCUGCGAUAAGCGUCGGUAAGGUGAUAUGAACCGUUAUAACCGGCGAUUUCCGAAUGGGGAAACCCAGUGUGUUUCGACACACUAUCAUUAACUGAAUCCAUAGGUUAAUGAGGCGAACCGGGGGAACUGAAACAUCUAAGUACCCCGAGGAAAAGAAAUCAACCGAGAUUCCCCCAGUAGCGGCGAGCGAACGGGGAGCAGCCCAGAGCCUGAAUCAGUGUGUGUGUUAGUGGAAGCGUCUGGAAAGGCGUGCGAUACAGGGUGACAGCCCCGUACACAAAAAUGCACAUGCUGUGAGCUCGAUGAGUAGGGCGGGACACGUGGUAUCCUGUCUGAAUAUGGGGGGACCAUCCUCCAAGGCUAAAUACUCCUGACUGACCGAUAGUGAACCAGUACCGUGAGGGAAAGGCGAAAAGAACCCCGGCGAGGGGAGUGAAAAAGAACCUGAAACCGUGUACGUACAAGCAGUGGGAGCACGCUUAGGCGUGUGACUGCGUACCUUUUGUAUAAUGGGUCAGCGACUUAUAUUCUGUAGCAAGGUUAACCGAAUAGGGGAGCCGAAGGGAAACCGAGUCUUAACUGGGCGUUAAGUUGCAGGGUAUAGACCCGAAACCCGGUGAUCUAGCCAUGGGCAGGUUGAAGGUUGGGUAACACUAACUGGAGGACCGAACCGACUAAUGUUGAAAAAUUAGCGGAUGACUUGUGGCUGGGGGUGAAAGGCCAAUCAAACCGGGAGAUAGCUGGUUCUCCCCGAAAGCUAUUUAGGUAGCGCCUCGUGAAUUCAUCUCCGGGGGUAGAGCACUGUUUCGGCAAGGGGGUCAUCCCGACUUACCAACCCGAUGCAAACUGCGAAUACCGGAGAAUGUUAUCACGGGAGACACACGGCGGGUGCUAACGUCCGUCGUGAAGAGGGAAACAACCCAGACCGCCAGCUA	2905	Pattern-associated molecular patterns (PAMPs)	Natural	Immunostimulant	Toll-like receptor 13 (TLR13)	Toll-like receptor (TLR)	Mice	Plasma membrane	extracellular domain containing leucine-rich repeats and an intracellular domain that contains a conserved region called the Toll/IL-1 receptor (TIR) domain and the trans membrane domain	Q6R5N8.fasta	Q6R5N8	991	Activate NF-KB	NA	27756604	2016	Pubchem_assay
PRRID_1717	Bacterial 23S ribosomal RNA Click for more detail	Bacteria	GGUUAAGCGACUAAGCGUACACGGUGGAUGCCCUGGCAGUCAGAGGCGAUGAAGGACGUGCUAAUCUGCGAUAAGCGUCGGUAAGGUGAUAUGAACCGUUAUAACCGGCGAUUUCCGAAUGGGGAAACCCAGUGUGUUUCGACACACUAUCAUUAACUGAAUCCAUAGGUUAAUGAGGCGAACCGGGGGAACUGAAACAUCUAAGUACCCCGAGGAAAAGAAAUCAACCGAGAUUCCCCCAGUAGCGGCGAGCGAACGGGGAGCAGCCCAGAGCCUGAAUCAGUGUGUGUGUUAGUGGAAGCGUCUGGAAAGGCGUGCGAUACAGGGUGACAGCCCCGUACACAAAAAUGCACAUGCUGUGAGCUCGAUGAGUAGGGCGGGACACGUGGUAUCCUGUCUGAAUAUGGGGGGACCAUCCUCCAAGGCUAAAUACUCCUGACUGACCGAUAGUGAACCAGUACCGUGAGGGAAAGGCGAAAAGAACCCCGGCGAGGGGAGUGAAAAAGAACCUGAAACCGUGUACGUACAAGCAGUGGGAGCACGCUUAGGCGUGUGACUGCGUACCUUUUGUAUAAUGGGUCAGCGACUUAUAUUCUGUAGCAAGGUUAACCGAAUAGGGGAGCCGAAGGGAAACCGAGUCUUAACUGGGCGUUAAGUUGCAGGGUAUAGACCCGAAACCCGGUGAUCUAGCCAUGGGCAGGUUGAAGGUUGGGUAACACUAACUGGAGGACCGAACCGACUAAUGUUGAAAAAUUAGCGGAUGACUUGUGGCUGGGGGUGAAAGGCCAAUCAAACCGGGAGAUAGCUGGUUCUCCCCGAAAGCUAUUUAGGUAGCGCCUCGUGAAUUCAUCUCCGGGGGUAGAGCACUGUUUCGGCAAGGGGGUCAUCCCGACUUACCAACCCGAUGCAAACUGCGAAUACCGGAGAAUGUUAUCACGGGAGACACACGGCGGGUGCUAACGUCCGUCGUGAAGAGGGAAACAACCCAGACCGCCAGCUA	2905	Pattern-associated molecular patterns (PAMPs)	Natural	Immunostimulant	Toll-like receptor 13 (TLR13)	Toll-like receptor (TLR)	Mice	Plasma membrane	extracellular domain containing leucine-rich repeats and an intracellular domain that contains a conserved region called the Toll/IL-1 receptor (TIR) domain and the trans membrane domain	Q6R5N8.fasta	Q6R5N8	991	Activate NF-KB	NA	27756604	2016	Pubchem_assay
PRRID_1718	BpA Click for more detail	Helminths (others)	NA	NA	Pattern-associated molecular patterns (PAMPs)	Natural	Immunostimulant	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Mice (Murine)	NA	NA	Q9QUK6.fasta	Q9QUK6	835	Activation of caspase1	NA	27120222	2016	Pubchem_assay
PRRID_1718	BpA Click for more detail	Helminths (others)	NA	NA	Pattern-associated molecular patterns (PAMPs)	Natural	Immunostimulant	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Mice (Murine)	NA	NA	Q9QUK6.fasta	Q9QUK6	835	Activation of caspase1	NA	27120222	2016	Pubchem_assay
PRRID_1719	BpA Click for more detail	Brugia pahangi(others)	TTCTTCTTTCCATTCTTTTCCTTTCATCGTCAATTGTAGCACGGTTAAGCAATTCAGCTAATAAACACTACTTCTGCTTGATGCGTACAGGTGCCGAGGTATTGTTTATTGGCTGAGTGCTATACCTCCAGTATTCATCG	140	Pattern-associated molecular patterns (PAMPs)	Natural	Immunostimulant	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Mice	lymphatic vessels	NA	Q9QUK6.fasta	Q9QUK6	835	Activation of caspaseÔòª	NA	27120222	2016	Pubchem_assay
PRRID_1719	BpA Click for more detail	Brugia pahangi(others)	TTCTTCTTTCCATTCTTTTCCTTTCATCGTCAATTGTAGCACGGTTAAGCAATTCAGCTAATAAACACTACTTCTGCTTGATGCGTACAGGTGCCGAGGTATTGTTTATTGGCTGAGTGCTATACCTCCAGTATTCATCG	140	Pattern-associated molecular patterns (PAMPs)	Natural	Immunostimulant	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Mice	lymphatic vessels	NA	Q9QUK6.fasta	Q9QUK6	835	Activation of caspaseÔòª	NA	27120222	2016	Pubchem_assay

previous 1 2...22 23 242526 27 28...69 70 next