| Primary information |
|---|
| PRRID | PRRID_1658 |
| Ligand Name | type I interferons |
| Source | Host (Endogenous) (others) |
| Sequence of ligand | MYTVQSWTCICLIICSMQSVCHCCDWIRHHYGHLSSEYLSLLDQMGGDITKQDAPVFFPTSLYRHIDDAEVEDQVRFLKETIYQITKLFDGNMKSVTWDKKKLDDFLNILERQLENLKSCVSPAMKPEKRLKRYFKKLNKNVLRKMNYSAQAWELIRKETKRHLQRLDILAAQMY |
| Length | 175 |
| Type | Protein |
| Occurence | Natural |
| Role of Ligand | induces TLR7 and TLR 8 in salmon |
| Name of receptor | Toll-like receptor 8a1 (TLR8a1) |
| Type of receptor | Toll-like receptor (TLR) |
| Source | Atlantic salmon (Salmo salar) |
| Localization | highest expression in spleen and head kidney and relatively low expression in muscle, liver, gut, heart and gill |
| Domain | NA |
| Sequence of Receptor | NA |
| Swiss prot ID | NA |
| Length Of Receptor | NA |
| Function | antiviral response in salmon |
| Assay used | Real-time PCR |
| PMID | 24736205 |
| Year of Publication | 2014 |
| Pubchem assay | NA |
| Primary information |
|---|
| PRRID | PRRID_1658 |
| Ligand Name | type I interferons |
| Source | Host (Endogenous) (others) |
| Sequence of ligand | MYTVQSWTCICLIICSMQSVCHCCDWIRHHYGHLSSEYLSLLDQMGGDITKQDAPVFFPTSLYRHIDDAEVEDQVRFLKETIYQITKLFDGNMKSVTWDKKKLDDFLNILERQLENLKSCVSPAMKPEKRLKRYFKKLNKNVLRKMNYSAQAWELIRKETKRHLQRLDILAAQMY |
| Length | 175 |
| Type | Protein |
| Occurence | Natural |
| Role of Ligand | induces TLR7 and TLR 8 in salmon |
| Name of receptor | Toll-like receptor 8a1 (TLR8a1) |
| Type of receptor | Toll-like receptor (TLR) |
| Source | Atlantic salmon (Salmo salar) |
| Localization | highest expression in spleen and head kidney and relatively low expression in muscle, liver, gut, heart and gill |
| Domain | NA |
| Sequence of Receptor | NA |
| Swiss prot ID | NA |
| Length Of Receptor | NA |
| Function | antiviral response in salmon |
| Assay used | Real-time PCR |
| PMID | 24736205 |
| Year of Publication | 2014 |
| Pubchem assay | NA |