| Primary information |
|---|
| PRRID | PRRID_1706 |
| Ligand Name | 19 kDa lipoprotein |
| Source | Mycobacterium tuberculosis (Bacteria) |
| Sequence of ligand | MKRGLTVAVAGAAILVAGLSGCSSNKSTTGSGETTTAAGTTASPGAASGPKVVIDGKDQNVTGSVVCTTAAGNVNIAIGGAATGIAAVLTDGNPPEVKSVGLGNVNGVTLGYTSGTGQGNASATKDGSHYKITGTATGVDMANPMSPVNKSFEIEVTCS |
| Length | 159 |
| Type | NA |
| Occurence | Natural |
| Role of Ligand | Immunostimulant |
| Name of receptor | Toll-like receptor 2 (TLR2) |
| Type of receptor | Toll-like receptor (TLR) |
| Source | NA |
| Localization | NA |
| Domain | NA |
| Sequence of Receptor | NA |
| Swiss prot ID | NA |
| Length Of Receptor | NA |
| Function | Induces apoptosis and inhibits IFN- induced expression of several immune function genes |
| Assay used | NA |
| PMID | 26775799 |
| Year of Publication | 2016 |
| Pubchem assay | NA |
| Primary information |
|---|
| PRRID | PRRID_1706 |
| Ligand Name | 19 kDa lipoprotein |
| Source | Mycobacterium tuberculosis (Bacteria) |
| Sequence of ligand | MKRGLTVAVAGAAILVAGLSGCSSNKSTTGSGETTTAAGTTASPGAASGPKVVIDGKDQNVTGSVVCTTAAGNVNIAIGGAATGIAAVLTDGNPPEVKSVGLGNVNGVTLGYTSGTGQGNASATKDGSHYKITGTATGVDMANPMSPVNKSFEIEVTCS |
| Length | 159 |
| Type | NA |
| Occurence | Natural |
| Role of Ligand | Immunostimulant |
| Name of receptor | Toll-like receptor 2 (TLR2) |
| Type of receptor | Toll-like receptor (TLR) |
| Source | NA |
| Localization | NA |
| Domain | NA |
| Sequence of Receptor | NA |
| Swiss prot ID | NA |
| Length Of Receptor | NA |
| Function | Induces apoptosis and inhibits IFN- induced expression of several immune function genes |
| Assay used | NA |
| PMID | 26775799 |
| Year of Publication | 2016 |
| Pubchem assay | NA |