Primary information |
---|
PRRID | PRRID_1660 |
Ligand Name | type I interferons |
Source | Host (Endogenous) (others) |
Sequence of ligand | MYTVQSWTCICLIICSMQSVCHCCDWIRHHYGHLSSEYLSLLDQMGGDITKQDAPVFFPTSLYRHIDDAEVEDQVRFLKETIYQITKLFDGNMKSVTWDKKKLDDFLNILERQLENLKSCVSPAMKPEKRLKRYFKKLNKNVLRKMNYSAQAWELIRKETKRHLQRLDILAAQMY |
Length | 175 |
Type | Protein |
Occurence | Natural |
Role of Ligand | induces TLR7 and TLR 8 in salmon |
Name of receptor | Toll-like receptor 8b1 (TLR8b1) |
Type of receptor | Toll-like receptor (TLR) |
Source | Atlantic salmon (Salmo salar) |
Localization | highest expression in spleen and head kidney and relatively low expression in muscle, liver, gut, heart and gill |
Domain | NA |
Sequence of Receptor | S0F1A6.fasta |
Swiss prot ID | S0F1A6 |
Length Of Receptor | 1034 |
Function | antiviral response in salmon |
Assay used | Real-time PCR |
PMID | 24736205 |
Year of Publication | 2014 |
Pubchem assay | Pubchem_assay |
Primary information |
---|
PRRID | PRRID_1660 |
Ligand Name | type I interferons |
Source | Host (Endogenous) (others) |
Sequence of ligand | MYTVQSWTCICLIICSMQSVCHCCDWIRHHYGHLSSEYLSLLDQMGGDITKQDAPVFFPTSLYRHIDDAEVEDQVRFLKETIYQITKLFDGNMKSVTWDKKKLDDFLNILERQLENLKSCVSPAMKPEKRLKRYFKKLNKNVLRKMNYSAQAWELIRKETKRHLQRLDILAAQMY |
Length | 175 |
Type | Protein |
Occurence | Natural |
Role of Ligand | induces TLR7 and TLR 8 in salmon |
Name of receptor | Toll-like receptor 8b1 (TLR8b1) |
Type of receptor | Toll-like receptor (TLR) |
Source | Atlantic salmon (Salmo salar) |
Localization | highest expression in spleen and head kidney and relatively low expression in muscle, liver, gut, heart and gill |
Domain | NA |
Sequence of Receptor | S0F1A6.fasta |
Swiss prot ID | S0F1A6 |
Length Of Receptor | 1034 |
Function | antiviral response in salmon |
Assay used | Real-time PCR |
PMID | 24736205 |
Year of Publication | 2014 |
Pubchem assay | Pubchem_assay |