Browse result page of PRRDB 2.0
| PRRID | Name of Ligand | Source of ligand | Sequence of Ligand | Length of Ligand | Type of Ligand | Occurence | Role of Ligand | Name of Receptor | Type of Reeptor | Source of the Receptor | Localization | Domain | Sequence of Receptor | Swiss prot ID | Length of receptor | Function of Receptor | Assay used | PMID | Year of publication | Pubchem assay |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| PRRID_0750 | Phosphoprotein Click for more detail | Measles virus (virus) | MAEEQARHVKNGLECIRALKAEPIGSLAIEEAMAAWSEISDNPGQERATCREEKAGSSGLSKPCLSAIGSTEGGAPRIRGQGPGESDDDAETLGIPPRNLQASSTGLQCYYVYDHSGEAVKGIQDADSIMVQSGLDGDSTLSGGDNESENSDVDIGEPDTEGYAITDRGSAPISMGFRASDVETAEGGEIHELLRLQSRGNNFPKLGKTLNVPPPPDPGRASTSGTPIKKGTERRLASFGTEIASLLTGGATQCARKSPSEPSGPGAPAGNVPEYVSNAALIQEWTPESGTTISPRSQNNEEGGDYYDDELFSDVQDIKTALAKIHEDNQKIISKLESLLLLKGEVESIKKQINRQNISISTLEGHLSSIMIAIPGLGKDPNDPTADVEINPDLKPIIGRDSGRALAEVLKKPVASRQLQGMTNGRTSSRGQLLKEFQPKPIGKKMSSAVGFVPDTGPASRSVIRSIIKSSRLEEDRKRYLMTLLDDIKGANDLAKFHQMLMKIIMK | 507 | Protein | Natural | Suppress NF-κB and AP-1 activation (Upregulate host NF-κB negative regulator A20) | Toll-like receptor 1/2 (TLR1/2) | Toll-like receptor (TLR) | Human | NA | Leucine-rich Repeat (LRR) Domain | NA | NA | NA | Inhibit proinflammatory cytokine and chemokine production | NA | 20672047 | 2010 | NA |
| PRRID_0750 | Phosphoprotein Click for more detail | Measles virus (virus) | MAEEQARHVKNGLECIRALKAEPIGSLAIEEAMAAWSEISDNPGQERATCREEKAGSSGLSKPCLSAIGSTEGGAPRIRGQGPGESDDDAETLGIPPRNLQASSTGLQCYYVYDHSGEAVKGIQDADSIMVQSGLDGDSTLSGGDNESENSDVDIGEPDTEGYAITDRGSAPISMGFRASDVETAEGGEIHELLRLQSRGNNFPKLGKTLNVPPPPDPGRASTSGTPIKKGTERRLASFGTEIASLLTGGATQCARKSPSEPSGPGAPAGNVPEYVSNAALIQEWTPESGTTISPRSQNNEEGGDYYDDELFSDVQDIKTALAKIHEDNQKIISKLESLLLLKGEVESIKKQINRQNISISTLEGHLSSIMIAIPGLGKDPNDPTADVEINPDLKPIIGRDSGRALAEVLKKPVASRQLQGMTNGRTSSRGQLLKEFQPKPIGKKMSSAVGFVPDTGPASRSVIRSIIKSSRLEEDRKRYLMTLLDDIKGANDLAKFHQMLMKIIMK | 507 | Protein | Natural | Suppress NF-κB and AP-1 activation (Upregulate host NF-κB negative regulator A20) | Toll-like receptor 1/2 (TLR1/2) | Toll-like receptor (TLR) | Human | NA | Leucine-rich Repeat (LRR) Domain | NA | NA | NA | Inhibit proinflammatory cytokine and chemokine production | NA | 20672047 | 2010 | NA |
| PRRID_0751 | poly U Click for more detail | NA | NA | NA | Nucleic Acid | Synthetic | It led to the activation of NF-κB and upregulate the expression of the antiapoptotic protein Bcl-2. | Toll-like receptor 7 (TLR7) | Toll-like receptor (TLR) | Human | Lung cancer cells | NA | Q9NYK1.fasta | Q9NYK1 | 1049 | This resulted into increased tumor cell survival and resistance to apoptosis induced by chemotherapy. | ELISA | 20237413 | 2010 | Pubchem Assay |
| PRRID_0751 | poly U Click for more detail | NA | NA | NA | Nucleic Acid | Synthetic | It led to the activation of NF-κB and upregulate the expression of the antiapoptotic protein Bcl-2. | Toll-like receptor 7 (TLR7) | Toll-like receptor (TLR) | Human | Lung cancer cells | NA | Q9NYK1.fasta | Q9NYK1 | 1049 | This resulted into increased tumor cell survival and resistance to apoptosis induced by chemotherapy. | ELISA | 20237413 | 2010 | Pubchem Assay |
| PRRID_0753 | polyadenylic-polyuridylic acid Click for more detail | Bacteria | NA | NA | Nucleic Acid | Synthetic | Their binding leads to the enhanced production of IFN- | Toll-like receptor 3 (TLR3) | Toll-like receptor (TLR) | Human | mDCs | Leucine-rich Repeat (LRR) Domain | O15455.fasta | O15455 | 904 | It resulted in direct activation NK cells leading to high IFN-γ production. | NA | 20639488 | 2010 | Pubchem Assay |
| PRRID_0753 | polyadenylic-polyuridylic acid Click for more detail | Bacteria | NA | NA | Nucleic Acid | Synthetic | Their binding leads to the enhanced production of IFN- | Toll-like receptor 3 (TLR3) | Toll-like receptor (TLR) | Human | mDCs | Leucine-rich Repeat (LRR) Domain | O15455.fasta | O15455 | 904 | It resulted in direct activation NK cells leading to high IFN-γ production. | NA | 20639488 | 2010 | Pubchem Assay |
| PRRID_0755 | polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail | NA | C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O | NA | Nucleic Acid | Synthetic | It results mTOR positively regulates interleukin 1 beta (IL-1β), tumor necrosis factor alpha (TNFα) and interferon beta (IFN-β) expression, but negatively regulates IL-12p70 expression in keratinocytes | Toll-like receptor 3 (TLR3) | Toll-like receptor (TLR) | Human | Keratinocytes | Leucine-rich Repeat (LRR) Domain | O15455.fasta | O15455 | 904 | It leads to the inflammatory response from the immune system leads to the clearance of pathogens | NA | 20728939 | 2010 | Pubchem Assay |
| PRRID_0755 | polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail | NA | C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O | NA | Nucleic Acid | Synthetic | It results mTOR positively regulates interleukin 1 beta (IL-1β), tumor necrosis factor alpha (TNFα) and interferon beta (IFN-β) expression, but negatively regulates IL-12p70 expression in keratinocytes | Toll-like receptor 3 (TLR3) | Toll-like receptor (TLR) | Human | Keratinocytes | Leucine-rich Repeat (LRR) Domain | O15455.fasta | O15455 | 904 | It leads to the inflammatory response from the immune system leads to the clearance of pathogens | NA | 20728939 | 2010 | Pubchem Assay |
| PRRID_0756 | polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail | NA | C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O | NA | Nucleic Acid | Synthetic | Reduced HIV-1 expression | Toll-like receptor 3 (TLR3) | Toll-like receptor (TLR) | Human | Macrophages | Leucine-rich Repeat (LRR) Domain | O15455.fasta | O15455 | 904 | It leads to the clearance of the pathogen from the system | NA | 20719993 | 2010 | Pubchem Assay |
| PRRID_0756 | polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail | NA | C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O | NA | Nucleic Acid | Synthetic | Reduced HIV-1 expression | Toll-like receptor 3 (TLR3) | Toll-like receptor (TLR) | Human | Macrophages | Leucine-rich Repeat (LRR) Domain | O15455.fasta | O15455 | 904 | It leads to the clearance of the pathogen from the system | NA | 20719993 | 2010 | Pubchem Assay |
| PRRID_0758 | polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail | NA | C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O | NA | Nucleic Acid | Synthetic | NA | Toll-like receptor 3 (TLR3) | Toll-like receptor (TLR) | organotypic Human brain slice cultures | Astrocytes | Leucine-rich Repeat (LRR) Domain | O15455.fasta | O15455 | 904 | It improves the survival of neurons | NA | 20706642 | 2010 | Pubchem Assay |
| PRRID_0758 | polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail | NA | C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O | NA | Nucleic Acid | Synthetic | NA | Toll-like receptor 3 (TLR3) | Toll-like receptor (TLR) | organotypic Human brain slice cultures | Astrocytes | Leucine-rich Repeat (LRR) Domain | O15455.fasta | O15455 | 904 | It improves the survival of neurons | NA | 20706642 | 2010 | Pubchem Assay |
| PRRID_0760 | polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail | NA | C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O | NA | Nucleic Acid | Synthetic | induced the secretion of IL-6 and IL-8 | Toll-like receptor 3 (TLR3) | Toll-like receptor (TLR) | Human | primary corneal epithelial cells and primary conjunctival epithelial cells, endothelial cells and fibroblasts | Leucine-rich Repeat (LRR) Domain | O15455.fasta | O15455 | 904 | It has the role in the inflammation. | NA | 20703156 | 2010 | Pubchem Assay |
| PRRID_0760 | polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail | NA | C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O | NA | Nucleic Acid | Synthetic | induced the secretion of IL-6 and IL-8 | Toll-like receptor 3 (TLR3) | Toll-like receptor (TLR) | Human | primary corneal epithelial cells and primary conjunctival epithelial cells, endothelial cells and fibroblasts | Leucine-rich Repeat (LRR) Domain | O15455.fasta | O15455 | 904 | It has the role in the inflammation. | NA | 20703156 | 2010 | Pubchem Assay |
| PRRID_0762 | polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail | NA | C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O | NA | Nucleic Acid | Synthetic | Their binding leads to the enhanced production of type I IFNs | Toll-like receptor 3 (TLR3) | Toll-like receptor (TLR) | Human | mDCs | Leucine-rich Repeat (LRR) Domain | O15455.fasta | O15455 | 904 | It resulted in direct activation NK cells leading to high IFN-γ production in synergy with mDC-released soluble mediators induced by dsRNA | NA | 20639488 | 2010 | Pubchem Assay |
| PRRID_0762 | polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail | NA | C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O | NA | Nucleic Acid | Synthetic | Their binding leads to the enhanced production of type I IFNs | Toll-like receptor 3 (TLR3) | Toll-like receptor (TLR) | Human | mDCs | Leucine-rich Repeat (LRR) Domain | O15455.fasta | O15455 | 904 | It resulted in direct activation NK cells leading to high IFN-γ production in synergy with mDC-released soluble mediators induced by dsRNA | NA | 20639488 | 2010 | Pubchem Assay |
| PRRID_0763 | polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail | NA | C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O | NA | Nucleic Acid | Synthetic | Their binding leads to the enhanced production of type I IFNs | RIG-1 | Rig-like receptor (RLR) | Human | Nk cell and mDCs | NA | O95786.fasta | O95786 | 925 | It resulted in direct activation NK cells leading to high IFN-γ production in synergy with mDC-released soluble mediators induced by dsRNA | NA | 20639488 | 2010 | Pubchem Assay |
| PRRID_0763 | polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail | NA | C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O | NA | Nucleic Acid | Synthetic | Their binding leads to the enhanced production of type I IFNs | RIG-1 | Rig-like receptor (RLR) | Human | Nk cell and mDCs | NA | O95786.fasta | O95786 | 925 | It resulted in direct activation NK cells leading to high IFN-γ production in synergy with mDC-released soluble mediators induced by dsRNA | NA | 20639488 | 2010 | Pubchem Assay |
| PRRID_0764 | polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail | NA | C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O | NA | Nucleic Acid | Synthetic | Their binding leads to the enhanced production of type I IFNs | RIG-1 | Rig-like receptor (RLR) | Human | Nk cell and mDCs | NA | O95786.fasta | O95786 | 925 | It resulted in direct activation NK cells leading to high IFN-γ production in synergy with mDC-released soluble mediators induced by dsRNA | NA | 20639488 | 2010 | Pubchem Assay |
| PRRID_0764 | polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail | NA | C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O | NA | Nucleic Acid | Synthetic | Their binding leads to the enhanced production of type I IFNs | RIG-1 | Rig-like receptor (RLR) | Human | Nk cell and mDCs | NA | O95786.fasta | O95786 | 925 | It resulted in direct activation NK cells leading to high IFN-γ production in synergy with mDC-released soluble mediators induced by dsRNA | NA | 20639488 | 2010 | Pubchem Assay |
| PRRID_0765 | polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail | NA | C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O | NA | Nucleic Acid | Synthetic | The binding of ligand to TLR3 results into induction of type I interferon inducible antiviral factors, including APOBEC3G and tetherin. | Toll-like receptor 3 (TLR3) | Toll-like receptor (TLR) | Human | Monocyte-derived macrophages | Leucine-rich Repeat (LRR) Domain | O15455.fasta | O15455 | 904 | Activation of TLR-3 inhibits human immunodeficiency virus (HIV) replication and hence inhibits HIV-1 infection of macrophages | ELISA | 20636339 | 2010 | Pubchem Assay |
| PRRID_0765 | polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail | NA | C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O | NA | Nucleic Acid | Synthetic | The binding of ligand to TLR3 results into induction of type I interferon inducible antiviral factors, including APOBEC3G and tetherin. | Toll-like receptor 3 (TLR3) | Toll-like receptor (TLR) | Human | Monocyte-derived macrophages | Leucine-rich Repeat (LRR) Domain | O15455.fasta | O15455 | 904 | Activation of TLR-3 inhibits human immunodeficiency virus (HIV) replication and hence inhibits HIV-1 infection of macrophages | ELISA | 20636339 | 2010 | Pubchem Assay |
| PRRID_0766 | polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail | NA | C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O | NA | Nucleic Acid | Synthetic | The binding results into secretion of low amounts of IL-12(p70) and high levels of IL-10 ompared with adult cells | Toll-like receptor 3 (TLR3) | Toll-like receptor (TLR) | Human | Cord blood cells | Leucine-rich Repeat (LRR) Domain | O15455.fasta | O15455 | 904 | NA | NA | 20636030 | 2010 | Pubchem Assay |
| PRRID_0766 | polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail | NA | C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O | NA | Nucleic Acid | Synthetic | The binding results into secretion of low amounts of IL-12(p70) and high levels of IL-10 ompared with adult cells | Toll-like receptor 3 (TLR3) | Toll-like receptor (TLR) | Human | Cord blood cells | Leucine-rich Repeat (LRR) Domain | O15455.fasta | O15455 | 904 | NA | NA | 20636030 | 2010 | Pubchem Assay |
| PRRID_0769 | polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail | NA | C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O | NA | Nucleic Acid | Synthetic | It's binding induces the production of IL6, IL8, MMP3 and MMP3 | Toll-like receptor 3 (TLR3) | Toll-like receptor (TLR) | Human | Fibroblast Like Synoviocytes (FLS) | Leucine-rich Repeat (LRR) Domain | O15455.fasta | O15455 | 904 | It has a role in the pathogenesis of juvenile idiopathic arthritis and cartilage destruction | ELISA | 20571165 | 2010 | Pubchem Assay |
| PRRID_0769 | polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail | NA | C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O | NA | Nucleic Acid | Synthetic | It's binding induces the production of IL6, IL8, MMP3 and MMP3 | Toll-like receptor 3 (TLR3) | Toll-like receptor (TLR) | Human | Fibroblast Like Synoviocytes (FLS) | Leucine-rich Repeat (LRR) Domain | O15455.fasta | O15455 | 904 | It has a role in the pathogenesis of juvenile idiopathic arthritis and cartilage destruction | ELISA | 20571165 | 2010 | Pubchem Assay |
| PRRID_0770 | polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail | NA | C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O | NA | Nucleic Acid | Synthetic | Poly[I:C] stimulate the activaion of natural killer cells which leads to the secretion of IL-6 ,TNF-‚ç∫ and IFN- | Toll-like receptor 3 (TLR3) | Toll-like receptor (TLR) | Human | Natural Killer cells from peripheral blood | Leucine-rich Repeat (LRR) Domain | O15455.fasta | O15455 | 904 | It has a immunostimulatory role | Flex-Set cytokine assay | 20427039 | 2010 | Pubchem Assay |
| PRRID_0770 | polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail | NA | C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O | NA | Nucleic Acid | Synthetic | Poly[I:C] stimulate the activaion of natural killer cells which leads to the secretion of IL-6 ,TNF-‚ç∫ and IFN- | Toll-like receptor 3 (TLR3) | Toll-like receptor (TLR) | Human | Natural Killer cells from peripheral blood | Leucine-rich Repeat (LRR) Domain | O15455.fasta | O15455 | 904 | It has a immunostimulatory role | Flex-Set cytokine assay | 20427039 | 2010 | Pubchem Assay |
| PRRID_0771 | polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail | NA | C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O | NA | Nucleic Acid | Synthetic | Poly[I:C] stimulate the activaion of natural killer cells which leads to the secretion of IL-6 ,TNF-‚ç∫ and IFN- | MDA5 | Rig-like receptor (RLR) | Human | Natural Killer cells from peripheral blood | NA | Q53TB6.fasta | Q53TB6 | 435 | It has a immunostimulatory role | Flex-Set cytokine assay | 20427039 | 2010 | Pubchem Assay |
| PRRID_0771 | polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail | NA | C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O | NA | Nucleic Acid | Synthetic | Poly[I:C] stimulate the activaion of natural killer cells which leads to the secretion of IL-6 ,TNF-‚ç∫ and IFN- | MDA5 | Rig-like receptor (RLR) | Human | Natural Killer cells from peripheral blood | NA | Q53TB6.fasta | Q53TB6 | 435 | It has a immunostimulatory role | Flex-Set cytokine assay | 20427039 | 2010 | Pubchem Assay |
| PRRID_0778 | profilin-like protein Click for more detail | T. gondii (others) | MSDWDPVVKEWLVDTGYCCAGGIANAEDGVVFAAAADDDDGWSKLYKDDHEEDTIGEDGNACGKVSINEASTIKAAVDDGSAPNGVWIGGQKYKVVRPEKGFEYNDCTFDITMCARSKGGAHLIKTPNGSIVIALYDEEKEQDKGNSRTSALAFAEYLHQSGY | 163 | Protein | Natural | Upon recogniton by the TLR, it induces induces the recruitment of adaptor proteins MyD95 | MDA5 | Rig-like receptor (RLR) | Human | Cell surface | Leucine-rich Repeat (LRR) Domain | Q53TB6.fasta | Q53TB6 | 435 | It leadsto the secretion of the proinfalmmatory and IFN-‚ç∫ | NA | 20620129 | 2010 | Pubchem Assay |
| PRRID_0778 | profilin-like protein Click for more detail | T. gondii (others) | MSDWDPVVKEWLVDTGYCCAGGIANAEDGVVFAAAADDDDGWSKLYKDDHEEDTIGEDGNACGKVSINEASTIKAAVDDGSAPNGVWIGGQKYKVVRPEKGFEYNDCTFDITMCARSKGGAHLIKTPNGSIVIALYDEEKEQDKGNSRTSALAFAEYLHQSGY | 163 | Protein | Natural | Upon recogniton by the TLR, it induces induces the recruitment of adaptor proteins MyD95 | MDA5 | Rig-like receptor (RLR) | Human | Cell surface | Leucine-rich Repeat (LRR) Domain | Q53TB6.fasta | Q53TB6 | 435 | It leadsto the secretion of the proinfalmmatory and IFN-‚ç∫ | NA | 20620129 | 2010 | Pubchem Assay |
| PRRID_0781 | R-Lipopolysaccharide (LPS) Click for more detail | Salmonella minnesota (Bacteria) | CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC | NA | Lipopolysaccharide (LPS) | Natural | Activate monocytes and neutrophils with differential CD14 expression. | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Human | Monocytes and Neutrophils | Leucine-rich Repeat (LRR) Domain | O00206.fasta | O00206 | 839 | It leads to the inflammatory response from the immune system leads to the clearance of pathogens | NA | 20721471 | 2010 | Pubchem Assay |
| PRRID_0781 | R-Lipopolysaccharide (LPS) Click for more detail | Salmonella minnesota (Bacteria) | CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC | NA | Lipopolysaccharide (LPS) | Natural | Activate monocytes and neutrophils with differential CD14 expression. | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Human | Monocytes and Neutrophils | Leucine-rich Repeat (LRR) Domain | O00206.fasta | O00206 | 839 | It leads to the inflammatory response from the immune system leads to the clearance of pathogens | NA | 20721471 | 2010 | Pubchem Assay |
| PRRID_0782 | Resiquimod (R-848) Click for more detail | imidazoquinoline (others) | CCOCC1=NC2=C(N1CC(C)(C)O)C3=CC=CC=C3N=C2N | NA | Nucleic Acid | Synthetic | The binding results into the robust TNF-‚ç∫ and IL-12 production | Toll-like receptor 7/8 (TLR7/8) | Toll-like receptor (TLR) | Human | APCs | Leucine-rich Repeat (LRR) Domain | NA | NA | NA | NA | NA | 20636030 | 2010 | NA |
| PRRID_0782 | Resiquimod (R-848) Click for more detail | imidazoquinoline (others) | CCOCC1=NC2=C(N1CC(C)(C)O)C3=CC=CC=C3N=C2N | NA | Nucleic Acid | Synthetic | The binding results into the robust TNF-‚ç∫ and IL-12 production | Toll-like receptor 7/8 (TLR7/8) | Toll-like receptor (TLR) | Human | APCs | Leucine-rich Repeat (LRR) Domain | NA | NA | NA | NA | NA | 20636030 | 2010 | NA |
| PRRID_0783 | RID Click for more detail | Adenovirus(virus) | MVTPLLLLVCLPIIYASTTFAAVSHLDTDCLPALLTYLIFTSVCCTAICSIATFFVAIFQTADYLYVRVAYYRHHPQYRNHEVATLLCLS | 90 | Protein | Natural | Suppress NF-κB and AP-1 activation | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Human | NA | Leucine-rich Repeat (LRR) Domain | O00206.fasta | O00206 | 839 | Suppress MCP-1 and IL-8 production | NA | 20672047 | 2010 | Pubchem Assay |
| PRRID_0783 | RID Click for more detail | Adenovirus(virus) | MVTPLLLLVCLPIIYASTTFAAVSHLDTDCLPALLTYLIFTSVCCTAICSIATFFVAIFQTADYLYVRVAYYRHHPQYRNHEVATLLCLS | 90 | Protein | Natural | Suppress NF-κB and AP-1 activation | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Human | NA | Leucine-rich Repeat (LRR) Domain | O00206.fasta | O00206 | 839 | Suppress MCP-1 and IL-8 production | NA | 20672047 | 2010 | Pubchem Assay |
| PRRID_0785 | RNA40 Click for more detail | HIV-1 (virus) | NA | NA | Nucleic Acid | Natural | Activate IRF-7 mediated by MyD88 | Toll-like receptor 1/2 (TLR1/2) | Toll-like receptor (TLR) | Human | NA | Leucine-rich Repeat (LRR) Domain | NA | NA | NA | Activate pDCs | NA | 20672047 | 2010 | NA |
| PRRID_0785 | RNA40 Click for more detail | HIV-1 (virus) | NA | NA | Nucleic Acid | Natural | Activate IRF-7 mediated by MyD88 | Toll-like receptor 1/2 (TLR1/2) | Toll-like receptor (TLR) | Human | NA | Leucine-rich Repeat (LRR) Domain | NA | NA | NA | Activate pDCs | NA | 20672047 | 2010 | NA |
| PRRID_0787 | S-Lipopolysaccharide (LPS) Click for more detail | Salmonella abortus equi (Bacteria) | CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC | NA | Lipopolysaccharide (LPS) | Natural | Activate monocytes and neutrophils with differential CD14 expression. | Toll-like receptor 5 (TLR5) | Toll-like receptor (TLR) | Human | Monocytes and Neutrophils | Leucine-rich Repeat (LRR) Domain | O60602.fasta | O60602 | 858 | It leads to the inflammatory response from the immune system leads to the clearance of pathogens | NA | 20721471 | 2010 | Pubchem Assay |
| PRRID_0787 | S-Lipopolysaccharide (LPS) Click for more detail | Salmonella abortus equi (Bacteria) | CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC | NA | Lipopolysaccharide (LPS) | Natural | Activate monocytes and neutrophils with differential CD14 expression. | Toll-like receptor 5 (TLR5) | Toll-like receptor (TLR) | Human | Monocytes and Neutrophils | Leucine-rich Repeat (LRR) Domain | O60602.fasta | O60602 | 858 | It leads to the inflammatory response from the immune system leads to the clearance of pathogens | NA | 20721471 | 2010 | Pubchem Assay |
| PRRID_0788 | SE-derived secreted factor (SE-S) Click for more detail | Staphylococcus epidermidis strain 1457 (Bacteria) | MNYSKITVTLIIILLCTFSFEFSFNRFVQADESRPKIESLKKKSELDSTALYNIKTSYSQDNIILDIKNKTNSTQLLSNDLIFDDITLKEWNKNSLKTEFNSSEIANHFKGKKVDIFGIYYGANCIGEVSKRTGCIYGGITLHEEEKIDQKNSIGVNVFKDGSQQKGFMITTDKKEPTIQELDLKTRKVIQNQYKIYNSETGNIQKGYMEFHSNSSSFYYDLFNFKGKYSVDFLKFYNDNKTINSSNLHIDVYLYSQ | 257 | Soluble factor | Natural | TLR2 mediated SE-induced cytokine production such as TNF, CXCL1 and CXCL2 | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Human | human embryonic kidney cells, human whole blood and murine primary macrophages | Leucine-rich Repeat (LRR) Domain | O60603.fasta | O60603 | 784 | TLR2 mediates recognition of live SE and clearance of SE bacteremia. | Cytokines assay | 20404927 | 2010 | Pubchem Assay |
| PRRID_0788 | SE-derived secreted factor (SE-S) Click for more detail | Staphylococcus epidermidis strain 1457 (Bacteria) | MNYSKITVTLIIILLCTFSFEFSFNRFVQADESRPKIESLKKKSELDSTALYNIKTSYSQDNIILDIKNKTNSTQLLSNDLIFDDITLKEWNKNSLKTEFNSSEIANHFKGKKVDIFGIYYGANCIGEVSKRTGCIYGGITLHEEEKIDQKNSIGVNVFKDGSQQKGFMITTDKKEPTIQELDLKTRKVIQNQYKIYNSETGNIQKGYMEFHSNSSSFYYDLFNFKGKYSVDFLKFYNDNKTINSSNLHIDVYLYSQ | 257 | Soluble factor | Natural | TLR2 mediated SE-induced cytokine production such as TNF, CXCL1 and CXCL2 | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Human | human embryonic kidney cells, human whole blood and murine primary macrophages | Leucine-rich Repeat (LRR) Domain | O60603.fasta | O60603 | 784 | TLR2 mediates recognition of live SE and clearance of SE bacteremia. | Cytokines assay | 20404927 | 2010 | Pubchem Assay |
| PRRID_0790 | single-stranded RNA Click for more detail | Virus | NA | NA | Nucleic Acid | Natural | Activates NF-KB and MAPK which lead to the production of cytokines as TNF and other proinflammatory proteins | Toll-like receptor 7 (TLR7) | Toll-like receptor (TLR) | Human | NA | Leucine-rich Repeat (LRR) Domain | Q9NYK1.fasta | Q9NYK1 | 1049 | It coauses the inflammation | NA | 20740341 | 2010 | Pubchem Assay |
| PRRID_0790 | single-stranded RNA Click for more detail | Virus | NA | NA | Nucleic Acid | Natural | Activates NF-KB and MAPK which lead to the production of cytokines as TNF and other proinflammatory proteins | Toll-like receptor 7 (TLR7) | Toll-like receptor (TLR) | Human | NA | Leucine-rich Repeat (LRR) Domain | Q9NYK1.fasta | Q9NYK1 | 1049 | It coauses the inflammation | NA | 20740341 | 2010 | Pubchem Assay |
| PRRID_0791 | single-stranded RNA Click for more detail | Virus | NA | NA | Nucleic Acid | Natural | Activates NF-KB and MAPK which lead to the production of cytokines as TNF and other proinflammatory proteins | Toll-like receptor 8 (TLR8) | Toll-like receptor (TLR) | Human | NA | Leucine-rich Repeat (LRR) Domain | Q9NR97.fasta | Q9NR97 | 1041 | It coauses the inflammation | NA | 20740341 | 2010 | Pubchem Assay |
| PRRID_0791 | single-stranded RNA Click for more detail | Virus | NA | NA | Nucleic Acid | Natural | Activates NF-KB and MAPK which lead to the production of cytokines as TNF and other proinflammatory proteins | Toll-like receptor 8 (TLR8) | Toll-like receptor (TLR) | Human | NA | Leucine-rich Repeat (LRR) Domain | Q9NR97.fasta | Q9NR97 | 1041 | It coauses the inflammation | NA | 20740341 | 2010 | Pubchem Assay |
| PRRID_0793 | single-stranded RNA Click for more detail | Virus | NA | NA | Nucleic Acid | Natural | lipid mediators of inflammation | Toll-like receptor 8 (TLR8) | Toll-like receptor (TLR) | Human(Ovarian Cancer Patient) | NA | Leucine-rich Repeat (LRR) Domain | Q9NR97.fasta | Q9NR97 | 1041 | It leads to the inflammatory response from the immune system leads to the clearance of pathogens | NA | 20728343 | 2010 | Pubchem Assay |
| PRRID_0793 | single-stranded RNA Click for more detail | Virus | NA | NA | Nucleic Acid | Natural | lipid mediators of inflammation | Toll-like receptor 8 (TLR8) | Toll-like receptor (TLR) | Human(Ovarian Cancer Patient) | NA | Leucine-rich Repeat (LRR) Domain | Q9NR97.fasta | Q9NR97 | 1041 | It leads to the inflammatory response from the immune system leads to the clearance of pathogens | NA | 20728343 | 2010 | Pubchem Assay |
| PRRID_0794 | single-stranded RNA Click for more detail | HIV-1 (virus) | NA | NA | Nucleic Acid | Natural | It suppresses virus replication | Toll-like receptor 7 (TLR7) | Toll-like receptor (TLR) | Human | plasmacytoid DCs | Leucine-rich Repeat (LRR) Domain | Q9NYK1.fasta | Q9NYK1 | 1049 | It leads to the clearance of the pathogen from the system | NA | 20719993 | 2010 | Pubchem Assay |
| PRRID_0794 | single-stranded RNA Click for more detail | HIV-1 (virus) | NA | NA | Nucleic Acid | Natural | It suppresses virus replication | Toll-like receptor 7 (TLR7) | Toll-like receptor (TLR) | Human | plasmacytoid DCs | Leucine-rich Repeat (LRR) Domain | Q9NYK1.fasta | Q9NYK1 | 1049 | It leads to the clearance of the pathogen from the system | NA | 20719993 | 2010 | Pubchem Assay |
| PRRID_0795 | single-stranded RNA Click for more detail | HIV-1 (virus) | NA | NA | Nucleic Acid | Natural | It suppresses virus replication | Toll-like receptor 8 (TLR8) | Toll-like receptor (TLR) | Human | plasmacytoid DCs | Leucine-rich Repeat (LRR) Domain | Q9NR97.fasta | Q9NR97 | 1041 | It leads to the clearance of the pathogen from the system | NA | 20719993 | 2010 | Pubchem Assay |
| PRRID_0795 | single-stranded RNA Click for more detail | HIV-1 (virus) | NA | NA | Nucleic Acid | Natural | It suppresses virus replication | Toll-like receptor 8 (TLR8) | Toll-like receptor (TLR) | Human | plasmacytoid DCs | Leucine-rich Repeat (LRR) Domain | Q9NR97.fasta | Q9NR97 | 1041 | It leads to the clearance of the pathogen from the system | NA | 20719993 | 2010 | Pubchem Assay |
| PRRID_0796 | single-stranded RNA Click for more detail | Virus | NA | NA | Nucleic Acid | Natural | It produce pro-inflammatory cytokines including IFNα, TNFα and/or IL-12 | Toll-like receptor 7 (TLR7) | Toll-like receptor (TLR) | Human | DCs, monocytes, macrophages, lymphocytes, Langerhans cells, and NK cells | Leucine-rich Repeat (LRR) Domain | Q9NYK1.fasta | Q9NYK1 | 1049 | Itresults into the inflammatory response | NA | 20713100 | 2010 | Pubchem Assay |
| PRRID_0796 | single-stranded RNA Click for more detail | Virus | NA | NA | Nucleic Acid | Natural | It produce pro-inflammatory cytokines including IFNα, TNFα and/or IL-12 | Toll-like receptor 7 (TLR7) | Toll-like receptor (TLR) | Human | DCs, monocytes, macrophages, lymphocytes, Langerhans cells, and NK cells | Leucine-rich Repeat (LRR) Domain | Q9NYK1.fasta | Q9NYK1 | 1049 | Itresults into the inflammatory response | NA | 20713100 | 2010 | Pubchem Assay |
| PRRID_0797 | single-stranded RNA Click for more detail | Virus | NA | NA | Nucleic Acid | Natural | It produce pro-inflammatory cytokines including IFNα, TNFα and/or IL-12 | Toll-like receptor 8 (TLR8) | Toll-like receptor (TLR) | Human | DCs, monocytes, macrophages, lymphocytes, Langerhans cells, and NK cells | Leucine-rich Repeat (LRR) Domain | Q9NR97.fasta | Q9NR97 | 1041 | Itresults into the inflammatory response | NA | 20713100 | 2010 | Pubchem Assay |
| PRRID_0797 | single-stranded RNA Click for more detail | Virus | NA | NA | Nucleic Acid | Natural | It produce pro-inflammatory cytokines including IFNα, TNFα and/or IL-12 | Toll-like receptor 8 (TLR8) | Toll-like receptor (TLR) | Human | DCs, monocytes, macrophages, lymphocytes, Langerhans cells, and NK cells | Leucine-rich Repeat (LRR) Domain | Q9NR97.fasta | Q9NR97 | 1041 | Itresults into the inflammatory response | NA | 20713100 | 2010 | Pubchem Assay |
| PRRID_0798 | single-stranded RNA Click for more detail | West Nile Virus | NA | NA | Nucleic Acid | Natural | Upon recogniton by the TLR, it induces induces the recruitment of adaptor proteins TRIF | Toll-like receptor 3 (TLR3) | Toll-like receptor (TLR) | Human | Endosomes | Leucine-rich Repeat (LRR) Domain | O15455.fasta | O15455 | 904 | it lead to the secretion of IFN-β | NA | 20620129 | 2010 | Pubchem Assay |
| PRRID_0798 | single-stranded RNA Click for more detail | West Nile Virus | NA | NA | Nucleic Acid | Natural | Upon recogniton by the TLR, it induces induces the recruitment of adaptor proteins TRIF | Toll-like receptor 3 (TLR3) | Toll-like receptor (TLR) | Human | Endosomes | Leucine-rich Repeat (LRR) Domain | O15455.fasta | O15455 | 904 | it lead to the secretion of IFN-β | NA | 20620129 | 2010 | Pubchem Assay |
| PRRID_0799 | single-stranded RNA Click for more detail | VSV, Influenza virus | NA | NA | Nucleic Acid | Natural | Upon recogniton by the TLR, it induces induces the recruitment of adaptor proteins MyD89 | Toll-like receptor 7 (TLR7) | Toll-like receptor (TLR) | Human | Endosomes | Leucine-rich Repeat (LRR) Domain | Q9NYK1.fasta | Q9NYK1 | 1049 | It leadsto the secretion of the proinfalmmatory and IFN-‚ç∫ | NA | 20620129 | 2010 | Pubchem Assay |
| PRRID_0799 | single-stranded RNA Click for more detail | VSV, Influenza virus | NA | NA | Nucleic Acid | Natural | Upon recogniton by the TLR, it induces induces the recruitment of adaptor proteins MyD89 | Toll-like receptor 7 (TLR7) | Toll-like receptor (TLR) | Human | Endosomes | Leucine-rich Repeat (LRR) Domain | Q9NYK1.fasta | Q9NYK1 | 1049 | It leadsto the secretion of the proinfalmmatory and IFN-‚ç∫ | NA | 20620129 | 2010 | Pubchem Assay |
| PRRID_0800 | single-stranded RNA Click for more detail | RNA virus (Virus) | NA | NA | Nucleic Acid | Natural | Upon recogniton by the TLR, it induces induces the recruitment of adaptor proteins MyD90 | Toll-like receptor 8 (TLR8) | Toll-like receptor (TLR) | Human | Endosomes | Leucine-rich Repeat (LRR) Domain | Q9NR97.fasta | Q9NR97 | 1041 | It leadsto the secretion of the proinfalmmatory and IFN-‚ç∫ | NA | 20620129 | 2010 | Pubchem Assay |
| PRRID_0800 | single-stranded RNA Click for more detail | RNA virus (Virus) | NA | NA | Nucleic Acid | Natural | Upon recogniton by the TLR, it induces induces the recruitment of adaptor proteins MyD90 | Toll-like receptor 8 (TLR8) | Toll-like receptor (TLR) | Human | Endosomes | Leucine-rich Repeat (LRR) Domain | Q9NR97.fasta | Q9NR97 | 1041 | It leadsto the secretion of the proinfalmmatory and IFN-‚ç∫ | NA | 20620129 | 2010 | Pubchem Assay |
| PRRID_0801 | siSC2 dsRNA Click for more detail | NA | NA | NA | Nucleic Acid | Synthetic | Induce type 1 IFN production | Toll-like receptor 3 (TLR3)/Toll-like receptor 8 (TLR8) | Toll-like receptor (TLR) | Human | PBMCs | Leucine-rich Repeat (LRR) Domain | NA | NA | NA | Immunostimulation | NA | 20692289 | 2010 | NA |
| PRRID_0801 | siSC2 dsRNA Click for more detail | NA | NA | NA | Nucleic Acid | Synthetic | Induce type 1 IFN production | Toll-like receptor 3 (TLR3)/Toll-like receptor 8 (TLR8) | Toll-like receptor (TLR) | Human | PBMCs | Leucine-rich Repeat (LRR) Domain | NA | NA | NA | Immunostimulation | NA | 20692289 | 2010 | NA |
| PRRID_0802 | SitC-His Click for more detail | S. aureus (Bacteria) | NA | NA | Lipoprotein | Natural | Induce IL-6 and TNF-‚ç∫ release | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Human | Monocytes | Leucine-rich Repeat (LRR) Domain | O60603.fasta | O60603 | 784 | NA | NA | 20679445 | 2010 | Pubchem Assay |
| PRRID_0802 | SitC-His Click for more detail | S. aureus (Bacteria) | NA | NA | Lipoprotein | Natural | Induce IL-6 and TNF-‚ç∫ release | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Human | Monocytes | Leucine-rich Repeat (LRR) Domain | O60603.fasta | O60603 | 784 | NA | NA | 20679445 | 2010 | Pubchem Assay |
| PRRID_0803 | SitC-His Click for more detail | S. aureus (Bacteria) | NA | NA | Lipoprotein | Natural | Activation of NF- | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Human | HEK293 | Leucine-rich Repeat (LRR) Domain | O60603.fasta | O60603 | 784 | NA | NA | 20679445 | 2010 | Pubchem Assay |
| PRRID_0803 | SitC-His Click for more detail | S. aureus (Bacteria) | NA | NA | Lipoprotein | Natural | Activation of NF- | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Human | HEK293 | Leucine-rich Repeat (LRR) Domain | O60603.fasta | O60603 | 784 | NA | NA | 20679445 | 2010 | Pubchem Assay |
| PRRID_0810 | Stathmins Click for more detail | Human (others) | MASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDLSLEEIQKKLEAAEERRKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHIEEVRKNKESKDPADETEAD | 149 | Endogenous | Natural | Binding of stathmins to TLR3 activates downstream signalling pathways via TRIF and lead to the secretion of IL-6 and CXCL-8 | Toll-like receptor 3 (TLR3) | Toll-like receptor (TLR) | Human | Astrocytes and microglia | Leucine-rich Repeat (LRR) Domain | O15455.fasta | O15455 | 904 | It has a role in astrocyte-mediated neuroprotection and in morphogenesis in the CNS | NA | 20483774 | 2010 | Pubchem Assay |
| PRRID_0810 | Stathmins Click for more detail | Human (others) | MASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDLSLEEIQKKLEAAEERRKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHIEEVRKNKESKDPADETEAD | 149 | Endogenous | Natural | Binding of stathmins to TLR3 activates downstream signalling pathways via TRIF and lead to the secretion of IL-6 and CXCL-8 | Toll-like receptor 3 (TLR3) | Toll-like receptor (TLR) | Human | Astrocytes and microglia | Leucine-rich Repeat (LRR) Domain | O15455.fasta | O15455 | 904 | It has a role in astrocyte-mediated neuroprotection and in morphogenesis in the CNS | NA | 20483774 | 2010 | Pubchem Assay |
| PRRID_0816 | Tat Click for more detail | HIV-1 (virus) | MEPVDPRLEPWKHPGSQPKTACTNCYCKKCCFHCQVCFITKALGISYGRKKRRQRRRAHQNSQTHQASLSKQPTSQPRGDPTGPKE | 86 | Protein | Natural | Activate NF-κB (PKR-dependent) | Toll-like receptor 1/2 (TLR1/2) | Toll-like receptor (TLR) | Human | NA | Leucine-rich Repeat (LRR) Domain | NA | NA | NA | NA | NA | 20672047 | 2010 | NA |
| PRRID_0816 | Tat Click for more detail | HIV-1 (virus) | MEPVDPRLEPWKHPGSQPKTACTNCYCKKCCFHCQVCFITKALGISYGRKKRRQRRRAHQNSQTHQASLSKQPTSQPRGDPTGPKE | 86 | Protein | Natural | Activate NF-κB (PKR-dependent) | Toll-like receptor 1/2 (TLR1/2) | Toll-like receptor (TLR) | Human | NA | Leucine-rich Repeat (LRR) Domain | NA | NA | NA | NA | NA | 20672047 | 2010 | NA |
| PRRID_0818 | Triacylated lipopeptides Click for more detail | Bacteria | NA | NA | Lipopeptides | Natural | Activates NF-KB and MAPK which lead to the production of cytokines as TNF and other proinflammatory proteins | Toll-like receptor 2 (TLR2)-Toll-like receptor (TLR1 dimer) | Toll-like receptor (TLR) | Human | NA | Leucine-rich Repeat (LRR) Domain | NA | NA | NA | It coauses the inflammation | NA | 20740341 | 2010 | NA |
| PRRID_0818 | Triacylated lipopeptides Click for more detail | Bacteria | NA | NA | Lipopeptides | Natural | Activates NF-KB and MAPK which lead to the production of cytokines as TNF and other proinflammatory proteins | Toll-like receptor 2 (TLR2)-Toll-like receptor (TLR1 dimer) | Toll-like receptor (TLR) | Human | NA | Leucine-rich Repeat (LRR) Domain | NA | NA | NA | It coauses the inflammation | NA | 20740341 | 2010 | NA |
| PRRID_0819 | Triacylated lipopeptides Click for more detail | Bacteria and Mycobacteria | NA | NA | Lipopeptides | Natural | Upon recogniton by the TLR, it induces induces the recruitment of adaptor proteins MyD88,/TIRAP and aloow the rerutiment of downstream effector | Toll-like receptor 1/2 (TLR1/2) | Toll-like receptor (TLR) | Human | Cell surface | Leucine-rich Repeat (LRR) Domain | NA | NA | NA | It leadsto the secretion of the proinfalmmatory cytokines | NA | 20620129 | 2010 | NA |
| PRRID_0819 | Triacylated lipopeptides Click for more detail | Bacteria and Mycobacteria | NA | NA | Lipopeptides | Natural | Upon recogniton by the TLR, it induces induces the recruitment of adaptor proteins MyD88,/TIRAP and aloow the rerutiment of downstream effector | Toll-like receptor 1/2 (TLR1/2) | Toll-like receptor (TLR) | Human | Cell surface | Leucine-rich Repeat (LRR) Domain | NA | NA | NA | It leadsto the secretion of the proinfalmmatory cytokines | NA | 20620129 | 2010 | NA |
| PRRID_0825 | Unmethylated CpG DNA Click for more detail | Bacteria | NA | NA | Nucleic Acid | Natural | It leads to the maturation, differentiation, and/or proliferation of NK cells, T cells, B cells, monocytes and macrophages and production of pro-inflammatory and Th-1 biased cytokines | Toll-like receptor 9 (TLR9) | Toll-like receptor (TLR) | Human | B cells and pDC | NA | Q9NR96.fasta | Q9NR96 | 1032 | It has the role in the inflammation. | NA | 20713100 | 2010 | Pubchem Assay |
| PRRID_0825 | Unmethylated CpG DNA Click for more detail | Bacteria | NA | NA | Nucleic Acid | Natural | It leads to the maturation, differentiation, and/or proliferation of NK cells, T cells, B cells, monocytes and macrophages and production of pro-inflammatory and Th-1 biased cytokines | Toll-like receptor 9 (TLR9) | Toll-like receptor (TLR) | Human | B cells and pDC | NA | Q9NR96.fasta | Q9NR96 | 1032 | It has the role in the inflammation. | NA | 20713100 | 2010 | Pubchem Assay |
| PRRID_0826 | Unmethylated CpG DNA Click for more detail | Bacteria | NA | NA | Nucleic Acid | Natural | It leads to the activation of the TLR9 and results into the secretion of the cytokines | Toll-like receptor 9 (TLR9) | Toll-like receptor (TLR) | Human | NA | Leucine-rich Repeat (LRR) Domain | Q9NR96.fasta | Q9NR96 | 1032 | It has the role in the inflammation. | NA | 20706677 | 2010 | Pubchem Assay |
| PRRID_0826 | Unmethylated CpG DNA Click for more detail | Bacteria | NA | NA | Nucleic Acid | Natural | It leads to the activation of the TLR9 and results into the secretion of the cytokines | Toll-like receptor 9 (TLR9) | Toll-like receptor (TLR) | Human | NA | Leucine-rich Repeat (LRR) Domain | Q9NR96.fasta | Q9NR96 | 1032 | It has the role in the inflammation. | NA | 20706677 | 2010 | Pubchem Assay |
| PRRID_0827 | Unmethylated CpG DNA Click for more detail | Bacteria | NA | NA | Nucleic Acid | Synthetic | It's binding does not induces the production of IL6, IL8, MMP3 and MMP4 | Toll-like receptor 9 (TLR9) | Toll-like receptor (TLR) | Human | Fibroblast Like Synoviocytes (FLS) | Leucine-rich Repeat (LRR) Domain | Q9NR96.fasta | Q9NR96 | 1032 | It has a role in the pathogenesis of juvenile idiopathic arthritis and cartilage destruction | ELISA | 20571165 | 2010 | Pubchem Assay |
| PRRID_0827 | Unmethylated CpG DNA Click for more detail | Bacteria | NA | NA | Nucleic Acid | Synthetic | It's binding does not induces the production of IL6, IL8, MMP3 and MMP4 | Toll-like receptor 9 (TLR9) | Toll-like receptor (TLR) | Human | Fibroblast Like Synoviocytes (FLS) | Leucine-rich Repeat (LRR) Domain | Q9NR96.fasta | Q9NR96 | 1032 | It has a role in the pathogenesis of juvenile idiopathic arthritis and cartilage destruction | ELISA | 20571165 | 2010 | Pubchem Assay |
| PRRID_0830 | Uropathogenic E. coli Click for more detail | Bacteria | NA | NA | NA | Natural | Upon recogniton by the TLR, it induces induces the recruitment of adaptor proteins MyD94 | Toll-like receptor 9 (TLR9) | Toll-like receptor (TLR) | Human | Cell surface | Leucine-rich Repeat (LRR) Domain | Q9NR96.fasta | Q9NR96 | 1032 | It leadsto the secretion of the proinfalmmatory and IFN-‚ç∫ | NA | 20620129 | 2010 | Pubchem Assay |
| PRRID_0830 | Uropathogenic E. coli Click for more detail | Bacteria | NA | NA | NA | Natural | Upon recogniton by the TLR, it induces induces the recruitment of adaptor proteins MyD94 | Toll-like receptor 9 (TLR9) | Toll-like receptor (TLR) | Human | Cell surface | Leucine-rich Repeat (LRR) Domain | Q9NR96.fasta | Q9NR96 | 1032 | It leadsto the secretion of the proinfalmmatory and IFN-‚ç∫ | NA | 20620129 | 2010 | Pubchem Assay |
| PRRID_0831 | Viral DNA Click for more detail | herpes simplex virus (virus) | NA | NA | Nucleic Acid | Natural | NA | Toll-like receptor 9 (TLR9) | Toll-like receptor (TLR) | Human | NA | Leucine-rich Repeat (LRR) Domain | Q9NR96.fasta | Q9NR96 | 1032 | Induce IFN production | NA | 20672047 | 2010 | Pubchem Assay |
| PRRID_0831 | Viral DNA Click for more detail | herpes simplex virus (virus) | NA | NA | Nucleic Acid | Natural | NA | Toll-like receptor 9 (TLR9) | Toll-like receptor (TLR) | Human | NA | Leucine-rich Repeat (LRR) Domain | Q9NR96.fasta | Q9NR96 | 1032 | Induce IFN production | NA | 20672047 | 2010 | Pubchem Assay |
| PRRID_0836 | virions Click for more detail | EBV(virus) | MAKLETVTLGNIGKDGKQTLVLNPRGVNPTNGVASLSQAGAVPALEKRVTVSVSQPSRNRKNYKVQVKIQNPTACTANGSCDPSVTRQAYADVTFSFTQYSTDEERAFVRTELAALLASPLLIDAIDQLNPAY | NA | Virus | Natural | Release of monocyte chemoattractant protein-1 (MCP-1) and to an increase of several cytokine mRNA levels. | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Human | Monocytes | Leucine-rich Repeat (LRR) Domain | O60603.fasta | O60603 | 784 | It provides antiviral immunity. | NA | 20713890 | 2010 | Pubchem Assay |
| PRRID_0836 | virions Click for more detail | EBV(virus) | MAKLETVTLGNIGKDGKQTLVLNPRGVNPTNGVASLSQAGAVPALEKRVTVSVSQPSRNRKNYKVQVKIQNPTACTANGSCDPSVTRQAYADVTFSFTQYSTDEERAFVRTELAALLASPLLIDAIDQLNPAY | NA | Virus | Natural | Release of monocyte chemoattractant protein-1 (MCP-1) and to an increase of several cytokine mRNA levels. | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Human | Monocytes | Leucine-rich Repeat (LRR) Domain | O60603.fasta | O60603 | 784 | It provides antiviral immunity. | NA | 20713890 | 2010 | Pubchem Assay |
| PRRID_0837 | virions Click for more detail | herpes simplex virus (virus) | MAKLETVTLGNIGKDGKQTLVLNPRGVNPTNGVASLSQAGAVPALEKRVTVSVSQPSRNRKNYKVQVKIQNPTACTANGSCDPSVTRQAYADVTFSFTQYSTDEERAFVRTELAALLASPLLIDAIDQLNPAY | NA | Virus | Natural | NA | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Human | NA | Leucine-rich Repeat (LRR) Domain | O60603.fasta | O60603 | 784 | Induce cytokine production | NA | 20672047 | 2010 | Pubchem Assay |
| PRRID_0837 | virions Click for more detail | herpes simplex virus (virus) | MAKLETVTLGNIGKDGKQTLVLNPRGVNPTNGVASLSQAGAVPALEKRVTVSVSQPSRNRKNYKVQVKIQNPTACTANGSCDPSVTRQAYADVTFSFTQYSTDEERAFVRTELAALLASPLLIDAIDQLNPAY | NA | Virus | Natural | NA | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Human | NA | Leucine-rich Repeat (LRR) Domain | O60603.fasta | O60603 | 784 | Induce cytokine production | NA | 20672047 | 2010 | Pubchem Assay |
| PRRID_0838 | virions Click for more detail | Varicella-zoster (virus) | MAKLETVTLGNIGKDGKQTLVLNPRGVNPTNGVASLSQAGAVPALEKRVTVSVSQPSRNRKNYKVQVKIQNPTACTANGSCDPSVTRQAYADVTFSFTQYSTDEERAFVRTELAALLASPLLIDAIDQLNPAY | NA | Virus | Natural | NA | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Human | NA | Leucine-rich Repeat (LRR) Domain | O60603.fasta | O60603 | 784 | Induce cytokine production | NA | 20672047 | 2010 | Pubchem Assay |
| PRRID_0838 | virions Click for more detail | Varicella-zoster (virus) | MAKLETVTLGNIGKDGKQTLVLNPRGVNPTNGVASLSQAGAVPALEKRVTVSVSQPSRNRKNYKVQVKIQNPTACTANGSCDPSVTRQAYADVTFSFTQYSTDEERAFVRTELAALLASPLLIDAIDQLNPAY | NA | Virus | Natural | NA | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Human | NA | Leucine-rich Repeat (LRR) Domain | O60603.fasta | O60603 | 784 | Induce cytokine production | NA | 20672047 | 2010 | Pubchem Assay |
| PRRID_0842 | Vpr Click for more detail | HIV-1 (virus) | MEQAPEDQGPQREPHNEWTLELLEELKNEAVRHFPRIWLHGLGQHIYETYGDTWAGVEAIIRILQQLLFIHFRIGCRHSRIGVTQQRRARNGASRS | 96 | Protein | Natural | Activate NF-κB | Toll-like receptor 1/2 (TLR1/2) | Toll-like receptor (TLR) | Human | NA | Leucine-rich Repeat (LRR) Domain | NA | NA | NA | Enhance IL-6, IL-8, and IL-10 production | NA | 20672047 | 2010 | NA |
| PRRID_0842 | Vpr Click for more detail | HIV-1 (virus) | MEQAPEDQGPQREPHNEWTLELLEELKNEAVRHFPRIWLHGLGQHIYETYGDTWAGVEAIIRILQQLLFIHFRIGCRHSRIGVTQQRRARNGASRS | 96 | Protein | Natural | Activate NF-κB | Toll-like receptor 1/2 (TLR1/2) | Toll-like receptor (TLR) | Human | NA | Leucine-rich Repeat (LRR) Domain | NA | NA | NA | Enhance IL-6, IL-8, and IL-10 production | NA | 20672047 | 2010 | NA |
| PRRID_0843 | Vpu Click for more detail | HIV-1 (virus) | MQPIQIAIAALVVAIIIAIVVWSIVIIEYRKILRQRKIDRLIDRLIERAEDSGNESEGEISALVEMGVEMGHHAPWDIDDL | 81 | Protein | Natural | Inhibit NF-κB activation (Stabilize IκB) | Toll-like receptor 1/2 (TLR1/2) | Toll-like receptor (TLR) | Human | NA | Leucine-rich Repeat (LRR) Domain | NA | NA | NA | Suppress cytokine production | NA | 20672047 | 2010 | NA |
| PRRID_0843 | Vpu Click for more detail | HIV-1 (virus) | MQPIQIAIAALVVAIIIAIVVWSIVIIEYRKILRQRKIDRLIDRLIERAEDSGNESEGEISALVEMGVEMGHHAPWDIDDL | 81 | Protein | Natural | Inhibit NF-κB activation (Stabilize IκB) | Toll-like receptor 1/2 (TLR1/2) | Toll-like receptor (TLR) | Human | NA | Leucine-rich Repeat (LRR) Domain | NA | NA | NA | Suppress cytokine production | NA | 20672047 | 2010 | NA |
| PRRID_0844 | Whole bacteria Click for more detail | Legionella pneumophila (Bacteria) | NA | NA | Whole organism | Natural | It activates the p38 MAPK and JNK as well as recruitment of NF- | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Human | Primary human small airway epithelial cells (SAEC) | LRR | O60603.fasta | O60603 | 784 | hBD-2 elicits an antimicrobial effect on L. pneumophila. | ELISA | 20154223 | 2010 | Pubchem Assay |
| PRRID_0844 | Whole bacteria Click for more detail | Legionella pneumophila (Bacteria) | NA | NA | Whole organism | Natural | It activates the p38 MAPK and JNK as well as recruitment of NF- | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Human | Primary human small airway epithelial cells (SAEC) | LRR | O60603.fasta | O60603 | 784 | hBD-2 elicits an antimicrobial effect on L. pneumophila. | ELISA | 20154223 | 2010 | Pubchem Assay |