Browse result page of PRRDB 2.0

PRRID	Name of Ligand	Source of ligand	Sequence of Ligand	Length of Ligand	Type of Ligand	Occurence	Role of Ligand	Name of Receptor	Type of Reeptor	Source of the Receptor	Localization	Domain	Sequence of Receptor	Swiss prot ID	Length of receptor	Function of Receptor	Assay used	PMID	Year of publication	Pubchem assay
PRRID_0697	MxiI Click for more detail	Shigella flexneri (Bacteria)	MNYIYPVNQVDIIKASDFQSQEISSLEDVVSAKYSDIKMDTDIQVSQIMEMVSNPESLNPESLAKLQTTLSNYSIGVSLAGTLARKTVSAVETLLKS	97	Protein	Natural	It activates caspase-1 through NLRC4 and secrete IL-1Œ≤	Nod-like receptor C4 (NLRC4)	NOD-like receptor (NLR)	Mice	Bone marrow‚Äìderived macrophages	NA	Q3UP24.fasta	Q3UP24	1024	It leads to the clearance of the pathogen from the system	ELISA	20133635	2010	Pubchem Assay
PRRID_0697	MxiI Click for more detail	Shigella flexneri (Bacteria)	MNYIYPVNQVDIIKASDFQSQEISSLEDVVSAKYSDIKMDTDIQVSQIMEMVSNPESLNPESLAKLQTTLSNYSIGVSLAGTLARKTVSAVETLLKS	97	Protein	Natural	It activates caspase-1 through NLRC4 and secrete IL-1Œ≤	Nod-like receptor C4 (NLRC4)	NOD-like receptor (NLR)	Mice	Bone marrow‚Äìderived macrophages	NA	Q3UP24.fasta	Q3UP24	1024	It leads to the clearance of the pathogen from the system	ELISA	20133635	2010	Pubchem Assay
PRRID_0701	NA Click for more detail	Acanthocheilonema viteae(others)	NA	NA	Pattern-associated molecular patterns (PAMPs)	Natural	NA	Scavenger receptor class A	Scavenger receptor (SR)	Mice	lamina propria macrophage	NA	Q08857.fasta	Q08857	472	It protect against microbial induced pregnancy loss	NA	20711846	2010	Pubchem Assay
PRRID_0701	NA Click for more detail	Acanthocheilonema viteae(others)	NA	NA	Pattern-associated molecular patterns (PAMPs)	Natural	NA	Scavenger receptor class A	Scavenger receptor (SR)	Mice	lamina propria macrophage	NA	Q08857.fasta	Q08857	472	It protect against microbial induced pregnancy loss	NA	20711846	2010	Pubchem Assay
PRRID_0702	NA Click for more detail	Acanthocheilonema viteae(others)	NA	NA	Pattern-associated molecular patterns (PAMPs)	Natural	NA	Scavenger receptor class A	Scavenger receptor (SR)	Mice	lamina propria macrophage	NA	Q08857.fasta	Q08857	472	It protect against microbial induced pregnancy loss	NA	20711846	2010	Pubchem Assay
PRRID_0702	NA Click for more detail	Acanthocheilonema viteae(others)	NA	NA	Pattern-associated molecular patterns (PAMPs)	Natural	NA	Scavenger receptor class A	Scavenger receptor (SR)	Mice	lamina propria macrophage	NA	Q08857.fasta	Q08857	472	It protect against microbial induced pregnancy loss	NA	20711846	2010	Pubchem Assay
PRRID_0723	Pam3CSK4 Click for more detail	Bacteria	CCCCCCCCCCCCCCCC(=O)NC(CSCC(COC(=O)CCCCCCCCCCCCCCC)OC(=O)CCCCCCCCCCCCCCC)C(=O)NC(CO)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)O	NA	Lipopeptides	Synthetic	Binding of the ligand leads to Akt phosphorylation and activation of the transcription factor NF-Œ∫B which results in secretion of proinflammatory cytokines	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice	embryonic mouse telencephalon and NPC	Leucine-rich Repeat (LRR) Domain	Q9QUN7.fasta	Q9QUN7	784	its activation inhibits NPC proliferation and decreases cell proliferation.	NA	20456021	2010	Pubchem Assay
PRRID_0723	Pam3CSK4 Click for more detail	Bacteria	CCCCCCCCCCCCCCCC(=O)NC(CSCC(COC(=O)CCCCCCCCCCCCCCC)OC(=O)CCCCCCCCCCCCCCC)C(=O)NC(CO)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)O	NA	Lipopeptides	Synthetic	Binding of the ligand leads to Akt phosphorylation and activation of the transcription factor NF-Œ∫B which results in secretion of proinflammatory cytokines	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice	embryonic mouse telencephalon and NPC	Leucine-rich Repeat (LRR) Domain	Q9QUN7.fasta	Q9QUN7	784	its activation inhibits NPC proliferation and decreases cell proliferation.	NA	20456021	2010	Pubchem Assay
PRRID_0724	Pam3CSK4 Click for more detail	Bacteria	CCCCCCCCCCCCCCCC(=O)NC(CSCC(COC(=O)CCCCCCCCCCCCCCC)OC(=O)CCCCCCCCCCCCCCC)C(=O)NC(CO)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)O	NA	Lipopeptides	Synthetic	It mediates the effect through a TLR2/PI3K/Aktdependent mechanism.	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice	Heart	Leucine-rich Repeat (LRR) Domain	Q9QUN7.fasta	Q9QUN7	784	It induces induce cardioprotection against ischaemia/reperfusion injury	EMSA	20421349	2010	Pubchem Assay
PRRID_0724	Pam3CSK4 Click for more detail	Bacteria	CCCCCCCCCCCCCCCC(=O)NC(CSCC(COC(=O)CCCCCCCCCCCCCCC)OC(=O)CCCCCCCCCCCCCCC)C(=O)NC(CO)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)O	NA	Lipopeptides	Synthetic	It mediates the effect through a TLR2/PI3K/Aktdependent mechanism.	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice	Heart	Leucine-rich Repeat (LRR) Domain	Q9QUN7.fasta	Q9QUN7	784	It induces induce cardioprotection against ischaemia/reperfusion injury	EMSA	20421349	2010	Pubchem Assay
PRRID_0727	Pam3CysSK4 Click for more detail	Bacteria	CCCCCCCCCCCCCCCC(=O)NC(CSCC(COC(=O)CCCCCCCCCCCCCCC)OC(=O)CCCCCCCCCCCCCCC)C(=O)NC(CO)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)O	NA	Peptidoglycan	Synthetic	NA	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice (Murine)	Macropahges	Leucine-rich Repeat (LRR) Domain	Q9QUN7.fasta	Q9QUN7	784	Helps in IgM production and clear pathogen from blood	NA	20696824	2010	Pubchem Assay
PRRID_0727	Pam3CysSK4 Click for more detail	Bacteria	CCCCCCCCCCCCCCCC(=O)NC(CSCC(COC(=O)CCCCCCCCCCCCCCC)OC(=O)CCCCCCCCCCCCCCC)C(=O)NC(CO)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)O	NA	Peptidoglycan	Synthetic	NA	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice (Murine)	Macropahges	Leucine-rich Repeat (LRR) Domain	Q9QUN7.fasta	Q9QUN7	784	Helps in IgM production and clear pathogen from blood	NA	20696824	2010	Pubchem Assay
PRRID_0732	Peptidoglycan (PGN) Click for more detail	Gram-positive bacteria	CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N	NA	Peptidoglycan	Natural	NA	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice	Microglia	Leucine-rich Repeat (LRR) Domain	Q9QUN7.fasta	Q9QUN7	784	It boosted the ingestion of Alzheimer‚Äôs disease neurotoxic Amyloid Œ≤ (AŒ≤) protein in vitro	NA	20706642	2010	Pubchem Assay
PRRID_0732	Peptidoglycan (PGN) Click for more detail	Gram-positive bacteria	CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N	NA	Peptidoglycan	Natural	NA	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice	Microglia	Leucine-rich Repeat (LRR) Domain	Q9QUN7.fasta	Q9QUN7	784	It boosted the ingestion of Alzheimer‚Äôs disease neurotoxic Amyloid Œ≤ (AŒ≤) protein in vitro	NA	20706642	2010	Pubchem Assay
PRRID_0733	Peptidoglycan (PGN) Click for more detail	E. coli K12(Bacteria)	CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N	NA	Peptidoglycan	Natural	NA	Nucleotide Binding Oligomerization Domain Containing 2 (Nod2)	NOD-like receptor (NLR)	Mice (Murine)	Macropahges	NA	Q8K3Z0.fasta	Q8K3Z0	1020	NA	NA	20696824	2010	Pubchem Assay
PRRID_0733	Peptidoglycan (PGN) Click for more detail	E. coli K12(Bacteria)	CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N	NA	Peptidoglycan	Natural	NA	Nucleotide Binding Oligomerization Domain Containing 2 (Nod2)	NOD-like receptor (NLR)	Mice (Murine)	Macropahges	NA	Q8K3Z0.fasta	Q8K3Z0	1020	NA	NA	20696824	2010	Pubchem Assay
PRRID_0737	Peptidoglycan (PGN) Click for more detail	S. aureus (Bacteria)	CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N	NA	Peptidoglycan	Natural	PGN induced iNOS, COX-2 and proinflammatory cytokine expression was mediated through the TLR2/MyD88/PI3-kinase/AKT pathway, which in turn initiates IKKŒ±/Œ≤ and NF-Œ∫B.	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice (Murine)	Microglial cells	Leucine-rich Repeat (LRR) Domain	Q9QUN7.fasta	Q9QUN7	784	It enhances proinflammatory cytokine expression	Transfection and reporter gene assay	20451669	2010	Pubchem Assay
PRRID_0737	Peptidoglycan (PGN) Click for more detail	S. aureus (Bacteria)	CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N	NA	Peptidoglycan	Natural	PGN induced iNOS, COX-2 and proinflammatory cytokine expression was mediated through the TLR2/MyD88/PI3-kinase/AKT pathway, which in turn initiates IKKŒ±/Œ≤ and NF-Œ∫B.	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice (Murine)	Microglial cells	Leucine-rich Repeat (LRR) Domain	Q9QUN7.fasta	Q9QUN7	784	It enhances proinflammatory cytokine expression	Transfection and reporter gene assay	20451669	2010	Pubchem Assay
PRRID_0738	Peptidoglycan (PGN) Click for more detail	Borrelia burgdorferi(Bacteria)	CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N	NA	Peptidoglycan	Natural	Peptidoglycans are recognized by active NOD2 molecules and the adaptor molecule RICK is recruited, which ultimately leads to activation of NF-kB and transcription of cytokines	Nucleotide Binding Oligomerization Domain Containing 2 (Nod2)	NOD-like receptor (NLR)	Mice	PBMCs	NA	Q8K3Z0.fasta	Q8K3Z0	1020	It aids in the induction of inflammtory reaction against Borrelia burgdorferi	ELISA	20441518	2010	Pubchem Assay
PRRID_0738	Peptidoglycan (PGN) Click for more detail	Borrelia burgdorferi(Bacteria)	CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N	NA	Peptidoglycan	Natural	Peptidoglycans are recognized by active NOD2 molecules and the adaptor molecule RICK is recruited, which ultimately leads to activation of NF-kB and transcription of cytokines	Nucleotide Binding Oligomerization Domain Containing 2 (Nod2)	NOD-like receptor (NLR)	Mice	PBMCs	NA	Q8K3Z0.fasta	Q8K3Z0	1020	It aids in the induction of inflammtory reaction against Borrelia burgdorferi	ELISA	20441518	2010	Pubchem Assay
PRRID_0740	Peptidoglycan (PGN) Click for more detail	Gram-negative bacteria	CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N	NA	Peptidoglycan	Synthetic	It mediates the effect through a TLR2/PI3K/Aktdependent mechanism.	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice	Heart	Leucine-rich Repeat (LRR) Domain	Q9QUN7.fasta	Q9QUN7	784	It induces induce cardioprotection against ischaemia/reperfusion injury	EMSA	20421349	2010	Pubchem Assay
PRRID_0740	Peptidoglycan (PGN) Click for more detail	Gram-negative bacteria	CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N	NA	Peptidoglycan	Synthetic	It mediates the effect through a TLR2/PI3K/Aktdependent mechanism.	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice	Heart	Leucine-rich Repeat (LRR) Domain	Q9QUN7.fasta	Q9QUN7	784	It induces induce cardioprotection against ischaemia/reperfusion injury	EMSA	20421349	2010	Pubchem Assay
PRRID_0745	Peptidoglycan (PGN) Click for more detail	Gram-positive bacteria	CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N	NA	Peptidoglycan	Natural	Augment cytokines and chemokines expression and promoting enhanced PMN transalveolar migration and exaggerated lung inflammation in response to invading pathogens	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice	Lung's endothelial cell	Leucine-rich Repeat (LRR) Domain	Q9QUN7.fasta	Q9QUN7	784	It has the role in the inflammation.	NA	20706658	2010	Pubchem Assay
PRRID_0745	Peptidoglycan (PGN) Click for more detail	Gram-positive bacteria	CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N	NA	Peptidoglycan	Natural	Augment cytokines and chemokines expression and promoting enhanced PMN transalveolar migration and exaggerated lung inflammation in response to invading pathogens	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice	Lung's endothelial cell	Leucine-rich Repeat (LRR) Domain	Q9QUN7.fasta	Q9QUN7	784	It has the role in the inflammation.	NA	20706658	2010	Pubchem Assay
PRRID_0746	PGNmonomer Click for more detail	S. aureus (Bacteria)	CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N	NA	Peptidoglycan	Natural	It initiates the activation of NF-	Nucleotide Binding Oligomerization Domain Containing 2 (Nod2)	NOD-like receptor (NLR)	Mice (Murine)	NA	NA	Q8K3Z0.fasta	Q8K3Z0	1020	It act as potent costimulator of the innate immune system in the presence of TLR signals	Luciferase assay	20522786	2010	Pubchem Assay
PRRID_0746	PGNmonomer Click for more detail	S. aureus (Bacteria)	CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N	NA	Peptidoglycan	Natural	It initiates the activation of NF-	Nucleotide Binding Oligomerization Domain Containing 2 (Nod2)	NOD-like receptor (NLR)	Mice (Murine)	NA	NA	Q8K3Z0.fasta	Q8K3Z0	1020	It act as potent costimulator of the innate immune system in the presence of TLR signals	Luciferase assay	20522786	2010	Pubchem Assay
PRRID_0747	PGNpolymer Click for more detail	S. aureus (Bacteria)	CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N	NA	Peptidoglycan	Natural	It initiates the activation of NF-	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice	HEK293	Leucine-rich Repeat (LRR) Domain	Q9QUN7.fasta	Q9QUN7	784	It induced murine dendritic cell (DC) maturation and cytokine production.	Luciferase assay	20522786	2010	Pubchem Assay
PRRID_0747	PGNpolymer Click for more detail	S. aureus (Bacteria)	CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N	NA	Peptidoglycan	Natural	It initiates the activation of NF-	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice	HEK293	Leucine-rich Repeat (LRR) Domain	Q9QUN7.fasta	Q9QUN7	784	It induced murine dendritic cell (DC) maturation and cytokine production.	Luciferase assay	20522786	2010	Pubchem Assay
PRRID_0748	phenol-soluble modulin Click for more detail	Staphylococcus epidermis (Bacteria)	MSKLAEAIANTVKAAQDQDWTKLGTSIVDIVESGVSVLGKIFGF	44	Protein	Natural	Increases expression of macrophage inflammatory protein-2 , cytokine migration inhibitory factor (MIF), and TNF-Œ± and induces augment PMN migration.	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice	Lung's endothelial cell	Leucine-rich Repeat (LRR) Domain	Q9QUN7.fasta	Q9QUN7	784	It has the role in the inflammation.	NA	20706658	2010	Pubchem Assay
PRRID_0748	phenol-soluble modulin Click for more detail	Staphylococcus epidermis (Bacteria)	MSKLAEAIANTVKAAQDQDWTKLGTSIVDIVESGVSVLGKIFGF	44	Protein	Natural	Increases expression of macrophage inflammatory protein-2 , cytokine migration inhibitory factor (MIF), and TNF-Œ± and induces augment PMN migration.	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice	Lung's endothelial cell	Leucine-rich Repeat (LRR) Domain	Q9QUN7.fasta	Q9QUN7	784	It has the role in the inflammation.	NA	20706658	2010	Pubchem Assay
PRRID_0757	polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail	NA	C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O	NA	Nucleic Acid	Synthetic	enhance the efficacy of peptide-based cancer vaccines by promoting tumor specific T cell responses	Toll-like receptor 3 (TLR3)	Toll-like receptor (TLR)	Mice (Murine)	dendritic cells and macrophages	Leucine-rich Repeat (LRR) Domain	Q99MB1.fasta	Q99MB1	905	It has the role in the inflammation.	NA	20713100	2010	Pubchem Assay
PRRID_0757	polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail	NA	C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O	NA	Nucleic Acid	Synthetic	enhance the efficacy of peptide-based cancer vaccines by promoting tumor specific T cell responses	Toll-like receptor 3 (TLR3)	Toll-like receptor (TLR)	Mice (Murine)	dendritic cells and macrophages	Leucine-rich Repeat (LRR) Domain	Q99MB1.fasta	Q99MB1	905	It has the role in the inflammation.	NA	20713100	2010	Pubchem Assay
PRRID_0768	polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail	NA	C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O	NA	Nucleic Acid	Synthetic	It stimulates the release of TNF-‚ç∫, IL-6 and CXCL1, and nitric oxide by microglia	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Mice (Murine)	Primary Microglial cells	Leucine-rich Repeat (LRR) Domain	Q9QUK6.fasta	Q9QUK6	835	Poly(I:C) increases microglial phagocytosis and intracellular killing of Escherichia coli K1, a pathogenic encapsulated bacterial strain	Phagocytosis assay	20599470	2010	Pubchem Assay
PRRID_0768	polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail	NA	C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O	NA	Nucleic Acid	Synthetic	It stimulates the release of TNF-‚ç∫, IL-6 and CXCL1, and nitric oxide by microglia	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Mice (Murine)	Primary Microglial cells	Leucine-rich Repeat (LRR) Domain	Q9QUK6.fasta	Q9QUK6	835	Poly(I:C) increases microglial phagocytosis and intracellular killing of Escherichia coli K1, a pathogenic encapsulated bacterial strain	Phagocytosis assay	20599470	2010	Pubchem Assay
PRRID_0773	polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail	NA	C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O	NA	Nucleic Acid	Synthetic	It induces the release of microparticles by the macrophages	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Mice (Murine)	Macropahes	LRR	Q9QUK6.fasta	Q9QUK6	835	It leads to the release of MPs which act as the novel signals for innate immunity	Griess assay	20335312	2010	Pubchem Assay
PRRID_0773	polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail	NA	C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O	NA	Nucleic Acid	Synthetic	It induces the release of microparticles by the macrophages	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Mice (Murine)	Macropahes	LRR	Q9QUK6.fasta	Q9QUK6	835	It leads to the release of MPs which act as the novel signals for innate immunity	Griess assay	20335312	2010	Pubchem Assay
PRRID_0774	Polyporus polysaccharide Click for more detail	NA	NA	NA	Carbohydrate	Natural	enhanced cell-surface expression of CD86 and production of both interleukin (IL)-12p40 and IL-10	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Mice (Murine)	bone derived dendritic cells	Leucine-rich Repeat (LRR) Domain	Q9QUK6.fasta	Q9QUK6	835	It involved in BMDCs maturation by inducing phenotypic and functional hanges	ELISA	20673883	2010	Pubchem Assay
PRRID_0774	Polyporus polysaccharide Click for more detail	NA	NA	NA	Carbohydrate	Natural	enhanced cell-surface expression of CD86 and production of both interleukin (IL)-12p40 and IL-10	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Mice (Murine)	bone derived dendritic cells	Leucine-rich Repeat (LRR) Domain	Q9QUK6.fasta	Q9QUK6	835	It involved in BMDCs maturation by inducing phenotypic and functional hanges	ELISA	20673883	2010	Pubchem Assay
PRRID_0777	PrgJ Click for more detail	S. typhimurium (Bacteria)	MSIATIVPENAVIGQAVNIRSMETDIVSLDDRLLQAFSGSAIATAVDKQTITNRIEDPNLVTDPKELAISQEMISDYNLYVSMVSTLTRKGVGAVETLLRS	101	Protein	Natural	It activates caspase-1 through NLRC4 and secrete IL-1Œ≤	Nod-like receptor C4 (NLRC4)	NOD-like receptor (NLR)	Mice	Bone marrow‚Äìderived macrophages	NA	Q3UP24.fasta	Q3UP24	1024	It leads to the clearance of the pathogen from the system	ELISA	20133635	2010	Pubchem Assay
PRRID_0777	PrgJ Click for more detail	S. typhimurium (Bacteria)	MSIATIVPENAVIGQAVNIRSMETDIVSLDDRLLQAFSGSAIATAVDKQTITNRIEDPNLVTDPKELAISQEMISDYNLYVSMVSTLTRKGVGAVETLLRS	101	Protein	Natural	It activates caspase-1 through NLRC4 and secrete IL-1Œ≤	Nod-like receptor C4 (NLRC4)	NOD-like receptor (NLR)	Mice	Bone marrow‚Äìderived macrophages	NA	Q3UP24.fasta	Q3UP24	1024	It leads to the clearance of the pathogen from the system	ELISA	20133635	2010	Pubchem Assay
PRRID_0779	PS-G Click for more detail	Ganoderma lucidum (fungi)	NA	NA	Carbohydrate	Natural	Binding resulted into the activation of NF-	Toll-like receptor 5 (TLR5)	Toll-like receptor (TLR)	Mice (Murine)	bone derived dendritic cells	Leucine-rich Repeat (LRR) Domain	Q9JLF7.fasta	Q9JLF7	859	promote the activation and maturation of BMDCs and macrophages	NA	20673883	2010	Pubchem Assay
PRRID_0779	PS-G Click for more detail	Ganoderma lucidum (fungi)	NA	NA	Carbohydrate	Natural	Binding resulted into the activation of NF-	Toll-like receptor 5 (TLR5)	Toll-like receptor (TLR)	Mice (Murine)	bone derived dendritic cells	Leucine-rich Repeat (LRR) Domain	Q9JLF7.fasta	Q9JLF7	859	promote the activation and maturation of BMDCs and macrophages	NA	20673883	2010	Pubchem Assay
PRRID_0780	PscI Click for more detail	Pseudomonas aeruginosa (Bacteria)	MDISRMGAQAQITSLEELSGGPAGAAHVAEFERAMGGAGSLGGDLLSELGQIRERFSQAKQELQMELSTPGDDPNSLMQMQWSLMRITMQEELIAKTVGRMSQNVETLMKTQ	112	Protein	Natural	It activates caspase-1 through NLRC4 and secrete IL-1Œ≤	Nod-like receptor C4 (NLRC4)	NOD-like receptor (NLR)	Mice	Bone marrow‚Äìderived macrophages	NA	Q3UP24.fasta	Q3UP24	1024	It leads to the clearance of the pathogen from the system	ELISA	20133635	2010	Pubchem Assay
PRRID_0780	PscI Click for more detail	Pseudomonas aeruginosa (Bacteria)	MDISRMGAQAQITSLEELSGGPAGAAHVAEFERAMGGAGSLGGDLLSELGQIRERFSQAKQELQMELSTPGDDPNSLMQMQWSLMRITMQEELIAKTVGRMSQNVETLMKTQ	112	Protein	Natural	It activates caspase-1 through NLRC4 and secrete IL-1Œ≤	Nod-like receptor C4 (NLRC4)	NOD-like receptor (NLR)	Mice	Bone marrow‚Äìderived macrophages	NA	Q3UP24.fasta	Q3UP24	1024	It leads to the clearance of the pathogen from the system	ELISA	20133635	2010	Pubchem Assay
PRRID_0784	rlipo-D1E3 Click for more detail	Dengue virus(virus)	NA	NA	Recombinant lipoprotein	Synthetic	It activated the NF-	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice	Spleen cells and Bone-Marrow derived dendritic cells	Leucine-rich Repeat (LRR) Domain	Q9QUN7.fasta	Q9QUN7	784	It promote various immune responses by inducing different levels of biological cytokines and chemokines.	NF-	20478617	2010	Pubchem Assay
PRRID_0784	rlipo-D1E3 Click for more detail	Dengue virus(virus)	NA	NA	Recombinant lipoprotein	Synthetic	It activated the NF-	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice	Spleen cells and Bone-Marrow derived dendritic cells	Leucine-rich Repeat (LRR) Domain	Q9QUN7.fasta	Q9QUN7	784	It promote various immune responses by inducing different levels of biological cytokines and chemokines.	NF-	20478617	2010	Pubchem Assay
PRRID_0786	S-[2,3-bispalmitoyiloxy-(2R)-propyl]- R-cysteinyl-amido-monomethoxyl polyethylene glycol (BPPcysMPEG Click for more detail	NA	NA	NA	Adjuvant	Synthetic	It activates the TLR2/6 heterodimer.	Toll-like receptor 2/6 (TLR2/6)	Toll-like receptor (TLR)	Mice	Dendritic cells	NA	NA	NA	NA	It leads to efficient cross-priming against co-administered and linked antigens.	Cytotoxicity assay	20213735	2010	NA
PRRID_0786	S-[2,3-bispalmitoyiloxy-(2R)-propyl]- R-cysteinyl-amido-monomethoxyl polyethylene glycol (BPPcysMPEG Click for more detail	NA	NA	NA	Adjuvant	Synthetic	It activates the TLR2/6 heterodimer.	Toll-like receptor 2/6 (TLR2/6)	Toll-like receptor (TLR)	Mice	Dendritic cells	NA	NA	NA	NA	It leads to efficient cross-priming against co-administered and linked antigens.	Cytotoxicity assay	20213735	2010	NA
PRRID_0789	SE-derived secreted factor (SE-S) Click for more detail	Staphylococcus epidermidis strain 1457 (Bacteria)	MNYSKITVTLIIILLCTFSFEFSFNRFVQADESRPKIESLKKKSELDSTALYNIKTSYSQDNIILDIKNKTNSTQLLSNDLIFDDITLKEWNKNSLKTEFNSSEIANHFKGKKVDIFGIYYGANCIGEVSKRTGCIYGGITLHEEEKIDQKNSIGVNVFKDGSQQKGFMITTDKKEPTIQELDLKTRKVIQNQYKIYNSETGNIQKGYMEFHSNSSSFYYDLFNFKGKYSVDFLKFYNDNKTINSSNLHIDVYLYSQ	257	Soluble factor	Natural	TLR2 mediated SE-induced cytokine production such as TNF, CXCL1 and CXCL2	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice	human embryonic kidney cells, human whole blood and murine primary macrophages	Leucine-rich Repeat (LRR) Domain	Q99MB1.fasta	Q99MB1	905	TLR2 mediates recognition of live SE and clearance of SE bacteremia.	Cytokines assay	20404927	2010	Pubchem Assay
PRRID_0789	SE-derived secreted factor (SE-S) Click for more detail	Staphylococcus epidermidis strain 1457 (Bacteria)	MNYSKITVTLIIILLCTFSFEFSFNRFVQADESRPKIESLKKKSELDSTALYNIKTSYSQDNIILDIKNKTNSTQLLSNDLIFDDITLKEWNKNSLKTEFNSSEIANHFKGKKVDIFGIYYGANCIGEVSKRTGCIYGGITLHEEEKIDQKNSIGVNVFKDGSQQKGFMITTDKKEPTIQELDLKTRKVIQNQYKIYNSETGNIQKGYMEFHSNSSSFYYDLFNFKGKYSVDFLKFYNDNKTINSSNLHIDVYLYSQ	257	Soluble factor	Natural	TLR2 mediated SE-induced cytokine production such as TNF, CXCL1 and CXCL2	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice	human embryonic kidney cells, human whole blood and murine primary macrophages	Leucine-rich Repeat (LRR) Domain	Q99MB1.fasta	Q99MB1	905	TLR2 mediates recognition of live SE and clearance of SE bacteremia.	Cytokines assay	20404927	2010	Pubchem Assay
PRRID_0792	single-stranded RNA Click for more detail	Virus	NA	NA	Nucleic Acid	Natural	release of proinflammatory cytokines and Pathgen Clearance	Toll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Mice	NA	Leucine-rich Repeat (LRR) Domain	P58681.fasta	P58681	1050	It has the role in the inflammation.	NA	20739362	2010	Pubchem Assay
PRRID_0792	single-stranded RNA Click for more detail	Virus	NA	NA	Nucleic Acid	Natural	release of proinflammatory cytokines and Pathgen Clearance	Toll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Mice	NA	Leucine-rich Repeat (LRR) Domain	P58681.fasta	P58681	1050	It has the role in the inflammation.	NA	20739362	2010	Pubchem Assay
PRRID_0805	sonifilan Click for more detail	Schizophyllum commune (fungi)	C(C1C(C(C(C(O1)O)O)OC2C(C(C(C(O2)COC3C(C(C(C(O3)CO)O)O)O)O)OC4C(C(C(C(O4)CO)O)O)O)O)O)O	NA	Biological response modifiers (BRMs)	Natural	Medicinal properties	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Mice	dendritic cells and macrophages	Leucine-rich Repeat (LRR) Domain	Q9QUK6.fasta	Q9QUK6	835	used clinically for cancer therapy	NA	20699131	2010	Pubchem Assay
PRRID_0805	sonifilan Click for more detail	Schizophyllum commune (fungi)	C(C1C(C(C(C(O1)O)O)OC2C(C(C(C(O2)COC3C(C(C(C(O3)CO)O)O)O)O)OC4C(C(C(C(O4)CO)O)O)O)O)O)O	NA	Biological response modifiers (BRMs)	Natural	Medicinal properties	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Mice	dendritic cells and macrophages	Leucine-rich Repeat (LRR) Domain	Q9QUK6.fasta	Q9QUK6	835	used clinically for cancer therapy	NA	20699131	2010	Pubchem Assay
PRRID_0809	SS Rna and CpG DNA Click for more detail	Virus	NA	NA	Nucleic Acid	Natural	NA	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Mice (Murine)	NA	Leucine-rich Repeat (LRR) Domain	Q9NR96.fasta	Q9NR96	1032	NA	NA	20739519	2010	Pubchem Assay
PRRID_0809	SS Rna and CpG DNA Click for more detail	Virus	NA	NA	Nucleic Acid	Natural	NA	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Mice (Murine)	NA	Leucine-rich Repeat (LRR) Domain	Q9NR96.fasta	Q9NR96	1032	NA	NA	20739519	2010	Pubchem Assay
PRRID_0811	Stathmins Click for more detail	Human (others)	MASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDLSLEEIQKKLEAAEERRKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHIEEVRKNKESKDPADETEAD	149	Endogenous	Natural	Binding of stathmins to TLR3 activates downstream signalling pathways via TRIF and lead to the secretion of IL-6 and CXCL-8	Toll-like receptor 3 (TLR3)	Toll-like receptor (TLR)	Mice (Murine)	Astrocytes and microglia	Leucine-rich Repeat (LRR) Domain	Q99MB1.fasta	Q99MB1	905	It has a role in astrocyte-mediated neuroprotection and in morphogenesis in the CNS	NA	20483774	2010	Pubchem Assay
PRRID_0811	Stathmins Click for more detail	Human (others)	MASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDLSLEEIQKKLEAAEERRKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHIEEVRKNKESKDPADETEAD	149	Endogenous	Natural	Binding of stathmins to TLR3 activates downstream signalling pathways via TRIF and lead to the secretion of IL-6 and CXCL-8	Toll-like receptor 3 (TLR3)	Toll-like receptor (TLR)	Mice (Murine)	Astrocytes and microglia	Leucine-rich Repeat (LRR) Domain	Q99MB1.fasta	Q99MB1	905	It has a role in astrocyte-mediated neuroprotection and in morphogenesis in the CNS	NA	20483774	2010	Pubchem Assay
PRRID_0812	Surface structure Click for more detail	Virus	NA	NA	Pattern-associated molecular patterns (PAMPs)	Natural	NA	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice (Murine)	NA	Leucine-rich Repeat (LRR) Domain	Q9QUN7.fasta	Q9QUN7	784	NA	NA	20739519	2010	Pubchem Assay
PRRID_0812	Surface structure Click for more detail	Virus	NA	NA	Pattern-associated molecular patterns (PAMPs)	Natural	NA	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice (Murine)	NA	Leucine-rich Repeat (LRR) Domain	Q9QUN7.fasta	Q9QUN7	784	NA	NA	20739519	2010	Pubchem Assay
PRRID_0813	Surface structure Click for more detail	Virus	NA	NA	Pattern-associated molecular patterns (PAMPs)	Natural	NA	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Mice (Murine)	NA	Leucine-rich Repeat (LRR) Domain	Q9QUK6.fasta	Q9QUK6	835	NA	NA	20739519	2010	Pubchem Assay
PRRID_0813	Surface structure Click for more detail	Virus	NA	NA	Pattern-associated molecular patterns (PAMPs)	Natural	NA	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Mice (Murine)	NA	Leucine-rich Repeat (LRR) Domain	Q9QUK6.fasta	Q9QUK6	835	NA	NA	20739519	2010	Pubchem Assay
PRRID_0832	viral envelope proteins Click for more detail	RSV and MMTV (virus)	NA	NA	Nucleic Acid	Natural	NA	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Mice (Murine)	dendritic cells and macrophages	Leucine-rich Repeat (LRR) Domain	Q9QUK6.fasta	Q9QUK6	835	NA	NA	20713100	2010	Pubchem Assay
PRRID_0832	viral envelope proteins Click for more detail	RSV and MMTV (virus)	NA	NA	Nucleic Acid	Natural	NA	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Mice (Murine)	dendritic cells and macrophages	Leucine-rich Repeat (LRR) Domain	Q9QUK6.fasta	Q9QUK6	835	NA	NA	20713100	2010	Pubchem Assay
PRRID_0839	Virulence factor p60 Click for more detail	Listeriamonocytogenes (Bacteria)	MKKIMLVFITLILVSLPIAQQTEAKDASAFNKENSISSMAPPASPPASPKTPIEKKHADEIDKYIQGLDYNKNNVLVYHGDAVTNVPPRKGYKDGNEYIVVEKKKKSINQNNADIQVVNAISSLTYPGALVKANSELVENQPDVLPVKRDSLTLSIDLPGMTNQDNKIVVKNATKSNVNNAVNTLVERWNEKYAQAYPNVSAKIDYDDEMAYSESQLIAKFGTAFKAVNNSLNVNFGAISEGKMQEEVISFKQIYYNVNVNEPTRPSRFFGKAVTKEQLQALGVNAENPPAYISSVAYGRQVYLKLSTNSHSTKVKAAFDAAVSGKSVSGDVELTNIIKNSSFKAVIYGGSAKDEVQIIDGNLGDLRDILKKGATFNRETPGVPIAYTTNFLKDNELAVIKNNSEYIETTSKAYTDGKINIDHSGGYVAQFNISWDEVNYDPEGNEIVQHKNWSENNKSKLAHFTSSIYLPGNARNINVYAKECTGLAWEWWRTVIDDRNLPLVKNRNISIWGTTLYPKYSNKVDNPIE	529	Protein	Natural	It activates of nuclear factor kB (NF-kB) and induces proinflammatory cytokine production.	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Mice	Macropahes	LRR	Q9QUK6.fasta	Q9QUK6	835	It provides host resistance against infection with L. monocytogenes.	ELISA	20337701	2010	Pubchem Assay
PRRID_0839	Virulence factor p60 Click for more detail	Listeriamonocytogenes (Bacteria)	MKKIMLVFITLILVSLPIAQQTEAKDASAFNKENSISSMAPPASPPASPKTPIEKKHADEIDKYIQGLDYNKNNVLVYHGDAVTNVPPRKGYKDGNEYIVVEKKKKSINQNNADIQVVNAISSLTYPGALVKANSELVENQPDVLPVKRDSLTLSIDLPGMTNQDNKIVVKNATKSNVNNAVNTLVERWNEKYAQAYPNVSAKIDYDDEMAYSESQLIAKFGTAFKAVNNSLNVNFGAISEGKMQEEVISFKQIYYNVNVNEPTRPSRFFGKAVTKEQLQALGVNAENPPAYISSVAYGRQVYLKLSTNSHSTKVKAAFDAAVSGKSVSGDVELTNIIKNSSFKAVIYGGSAKDEVQIIDGNLGDLRDILKKGATFNRETPGVPIAYTTNFLKDNELAVIKNNSEYIETTSKAYTDGKINIDHSGGYVAQFNISWDEVNYDPEGNEIVQHKNWSENNKSKLAHFTSSIYLPGNARNINVYAKECTGLAWEWWRTVIDDRNLPLVKNRNISIWGTTLYPKYSNKVDNPIE	529	Protein	Natural	It activates of nuclear factor kB (NF-kB) and induces proinflammatory cytokine production.	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Mice	Macropahes	LRR	Q9QUK6.fasta	Q9QUK6	835	It provides host resistance against infection with L. monocytogenes.	ELISA	20337701	2010	Pubchem Assay
PRRID_0840	Virulence factor p60 Click for more detail	Listeriamonocytogenes (Bacteria)	MKKIMLVFITLILVSLPIAQQTEAKDASAFNKENSISSMAPPASPPASPKTPIEKKHADEIDKYIQGLDYNKNNVLVYHGDAVTNVPPRKGYKDGNEYIVVEKKKKSINQNNADIQVVNAISSLTYPGALVKANSELVENQPDVLPVKRDSLTLSIDLPGMTNQDNKIVVKNATKSNVNNAVNTLVERWNEKYAQAYPNVSAKIDYDDEMAYSESQLIAKFGTAFKAVNNSLNVNFGAISEGKMQEEVISFKQIYYNVNVNEPTRPSRFFGKAVTKEQLQALGVNAENPPAYISSVAYGRQVYLKLSTNSHSTKVKAAFDAAVSGKSVSGDVELTNIIKNSSFKAVIYGGSAKDEVQIIDGNLGDLRDILKKGATFNRETPGVPIAYTTNFLKDNELAVIKNNSEYIETTSKAYTDGKINIDHSGGYVAQFNISWDEVNYDPEGNEIVQHKNWSENNKSKLAHFTSSIYLPGNARNINVYAKECTGLAWEWWRTVIDDRNLPLVKNRNISIWGTTLYPKYSNKVDNPIE	529	Protein	Natural	It activates of nuclear factor kB (NF-kB) and induces proinflammatory cytokine production.	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Mice	Macrophage RAW264.7 cells	LRR	Q9QUK6.fasta	Q9QUK6	835	It provides host resistance against infection with L. monocytogenes.	ELISA	20337701	2010	Pubchem Assay
PRRID_0840	Virulence factor p60 Click for more detail	Listeriamonocytogenes (Bacteria)	MKKIMLVFITLILVSLPIAQQTEAKDASAFNKENSISSMAPPASPPASPKTPIEKKHADEIDKYIQGLDYNKNNVLVYHGDAVTNVPPRKGYKDGNEYIVVEKKKKSINQNNADIQVVNAISSLTYPGALVKANSELVENQPDVLPVKRDSLTLSIDLPGMTNQDNKIVVKNATKSNVNNAVNTLVERWNEKYAQAYPNVSAKIDYDDEMAYSESQLIAKFGTAFKAVNNSLNVNFGAISEGKMQEEVISFKQIYYNVNVNEPTRPSRFFGKAVTKEQLQALGVNAENPPAYISSVAYGRQVYLKLSTNSHSTKVKAAFDAAVSGKSVSGDVELTNIIKNSSFKAVIYGGSAKDEVQIIDGNLGDLRDILKKGATFNRETPGVPIAYTTNFLKDNELAVIKNNSEYIETTSKAYTDGKINIDHSGGYVAQFNISWDEVNYDPEGNEIVQHKNWSENNKSKLAHFTSSIYLPGNARNINVYAKECTGLAWEWWRTVIDDRNLPLVKNRNISIWGTTLYPKYSNKVDNPIE	529	Protein	Natural	It activates of nuclear factor kB (NF-kB) and induces proinflammatory cytokine production.	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Mice	Macrophage RAW264.7 cells	LRR	Q9QUK6.fasta	Q9QUK6	835	It provides host resistance against infection with L. monocytogenes.	ELISA	20337701	2010	Pubchem Assay
PRRID_0841	Virus Click for more detail	T. gondii (others)	NA	NA	Pattern-associated molecular patterns (PAMPs)	Natural	It induces Crp-3/-5 production and release by PCs via a TLR9-dependent production of type I IFNs	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	C57BL/6 Mice	epithial cells	Leucine-rich Repeat (LRR) Domain	Q9NR96.fasta	Q9NR96	1032	It affect the early control of T. gondii invasiveness by promoting the initiation of a protective Th1 response against the parasite	NA	20488791	2010	Pubchem Assay
PRRID_0841	Virus Click for more detail	T. gondii (others)	NA	NA	Pattern-associated molecular patterns (PAMPs)	Natural	It induces Crp-3/-5 production and release by PCs via a TLR9-dependent production of type I IFNs	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	C57BL/6 Mice	epithial cells	Leucine-rich Repeat (LRR) Domain	Q9NR96.fasta	Q9NR96	1032	It affect the early control of T. gondii invasiveness by promoting the initiation of a protective Th1 response against the parasite	NA	20488791	2010	Pubchem Assay
PRRID_0849	Zymosan Click for more detail	Fungi	C(C1C(C(C(C(O1)O)O)O)O)O	NA	Glucan	Natural	Increases expression of macrophage inflammatory protein-2 , cytokine migration inhibitory factor (MIF), and TNF-Œ± and induces augment PMN migration.	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice	Lung's endothelial cell	Leucine-rich Repeat (LRR) Domain	Q9QUN7.fasta	Q9QUN7	784	It has the role in the inflammation.	NA	20706658	2010	Pubchem Assay
PRRID_0849	Zymosan Click for more detail	Fungi	C(C1C(C(C(C(O1)O)O)O)O)O	NA	Glucan	Natural	Increases expression of macrophage inflammatory protein-2 , cytokine migration inhibitory factor (MIF), and TNF-Œ± and induces augment PMN migration.	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice	Lung's endothelial cell	Leucine-rich Repeat (LRR) Domain	Q9QUN7.fasta	Q9QUN7	784	It has the role in the inflammation.	NA	20706658	2010	Pubchem Assay
PRRID_0863	LTA Click for more detail	Gram-positive bacteria	C(C1C(C(C(C(O1)OCC(CO)O)OC2C(C(C(C(O2)COP(=O)(O)OCC(COP(=O)(O)OCC(COP(=O)(O)OCC(COP(=O)(O)OCC(CO)O)O)O)O)O)O)O)O)O)O	NA	Pattern-associated molecular patterns (PAMPs)	Natural	Augment cytokines and chemokines expression and promoting enhanced PMN transalveolar migration and exaggerated lung inflammation in response to invading pathogens	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice	Lung's endothelial cell	Leucine-rich Repeat (LRR) Domain	Q9QUN7.fasta	Q9QUN7	784	It has the role in the inflammation.	NA	20706658	2010	Pubchem Assay
PRRID_0863	LTA Click for more detail	Gram-positive bacteria	C(C1C(C(C(C(O1)OCC(CO)O)OC2C(C(C(C(O2)COP(=O)(O)OCC(COP(=O)(O)OCC(COP(=O)(O)OCC(COP(=O)(O)OCC(CO)O)O)O)O)O)O)O)O)O)O	NA	Pattern-associated molecular patterns (PAMPs)	Natural	Augment cytokines and chemokines expression and promoting enhanced PMN transalveolar migration and exaggerated lung inflammation in response to invading pathogens	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice	Lung's endothelial cell	Leucine-rich Repeat (LRR) Domain	Q9QUN7.fasta	Q9QUN7	784	It has the role in the inflammation.	NA	20706658	2010	Pubchem Assay
PRRID_0879	dsRNA Click for more detail	Virus	NA	NA	Nucleic Acid	Natural	triggers immune responses	Toll-like receptor 3 (TLR3)	Toll-like receptor (TLR)	Mice	NA	intracellular TIR domains	Q99MB1.fasta	Q99MB1	905	TLR3 ligands induced the release of both proinflammatory cytokines [interleukin (IL)-6 and IL-8] and type I interferon by nmMSCs compared with other TLR ligands	NA	21959264	2011	Pubchem Assay
PRRID_0879	dsRNA Click for more detail	Virus	NA	NA	Nucleic Acid	Natural	triggers immune responses	Toll-like receptor 3 (TLR3)	Toll-like receptor (TLR)	Mice	NA	intracellular TIR domains	Q99MB1.fasta	Q99MB1	905	TLR3 ligands induced the release of both proinflammatory cytokines [interleukin (IL)-6 and IL-8] and type I interferon by nmMSCs compared with other TLR ligands	NA	21959264	2011	Pubchem Assay
PRRID_0907	Heparan sulfate Click for more detail	NA	COC1C(C(C(OC1C(=O)[O-])OC2C(OC(C(C2[O-])NOS(=O)(=O)O)OC)COS(=O)(=O)O)OS(=O)(=O)O)O	NA	Damage-associated molecular patterns (DAMPs)	Natural	induce the maturation of DCs	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Mice (Murine)	neutrophils, macrophages, and dendritic cells	TIR domain- containing adaptor protein-inducing IFN-	Q9QUK6.fasta	Q9QUK6	835	triggers the innate immune response and leads to the induction of adaptive immunity	NA	21949773	2011	Pubchem Assay
PRRID_0907	Heparan sulfate Click for more detail	NA	COC1C(C(C(OC1C(=O)[O-])OC2C(OC(C(C2[O-])NOS(=O)(=O)O)OC)COS(=O)(=O)O)OS(=O)(=O)O)O	NA	Damage-associated molecular patterns (DAMPs)	Natural	induce the maturation of DCs	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Mice (Murine)	neutrophils, macrophages, and dendritic cells	TIR domain- containing adaptor protein-inducing IFN-	Q9QUK6.fasta	Q9QUK6	835	triggers the innate immune response and leads to the induction of adaptive immunity	NA	21949773	2011	Pubchem Assay
PRRID_0909	HMGB1 Click for more detail	Endogenous (others)	MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEDDEEDEEDEEEEEEEEDEDEEEDDDDE	215	Protein	Natural	HMGB1 plays a pivotal role in ischemic brain injury	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Mice (Murine)	neutrophils, macrophages, and dendritic cells	TIR domain- containing adaptor protein-inducing IFN-	Q9QUK6.fasta	Q9QUK6	835	triggers the innate immune response and leads to the induction of adaptive immunity	NA	21949773	2011	Pubchem Assay
PRRID_0909	HMGB1 Click for more detail	Endogenous (others)	MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEDDEEDEEDEEEEEEEEDEDEEEDDDDE	215	Protein	Natural	HMGB1 plays a pivotal role in ischemic brain injury	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Mice (Murine)	neutrophils, macrophages, and dendritic cells	TIR domain- containing adaptor protein-inducing IFN-	Q9QUK6.fasta	Q9QUK6	835	triggers the innate immune response and leads to the induction of adaptive immunity	NA	21949773	2011	Pubchem Assay
PRRID_0921	Lipopolysaccharide (LPS) Click for more detail	Gram-negative bacteria	CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC	NA	Lipopolysaccharide (LPS)	Natural	LPS was also shown to play a role in alloimmune lung injury	Toll-like receptor 4/MD-2 (TLR4/MD-2)	Toll-like receptor (TLR)	Mice	NA	intracellular TIR domains	Q9QUK6.fasta	Q9QUK6	835	TLR 4 leads to an intracellular signaling pathway¬†NF-Œ∫B and inflammatory cytokine production which is responsible for activating the innate immune system	NA	21959264	2011	Pubchem Assay
PRRID_0921	Lipopolysaccharide (LPS) Click for more detail	Gram-negative bacteria	CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC	NA	Lipopolysaccharide (LPS)	Natural	LPS was also shown to play a role in alloimmune lung injury	Toll-like receptor 4/MD-2 (TLR4/MD-2)	Toll-like receptor (TLR)	Mice	NA	intracellular TIR domains	Q9QUK6.fasta	Q9QUK6	835	TLR 4 leads to an intracellular signaling pathway¬†NF-Œ∫B and inflammatory cytokine production which is responsible for activating the innate immune system	NA	21959264	2011	Pubchem Assay
PRRID_0924	Lipopolysaccharide (LPS) Click for more detail	Gram-negative bacteria	CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC	NA	Lipopolysaccharide (LPS)	Natural	LPS was also shown to play a role in alloimmune lung injury	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Mice (Murine)	neutrophils, macrophages, and dendritic cells	TIR domain- containing adaptor protein-inducing IFN-	Q9QUK6.fasta	Q9QUK6	835	triggers the innate immune response and leads to the induction of adaptive immunity	NA	21949773	2011	Pubchem Assay
PRRID_0924	Lipopolysaccharide (LPS) Click for more detail	Gram-negative bacteria	CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC	NA	Lipopolysaccharide (LPS)	Natural	LPS was also shown to play a role in alloimmune lung injury	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Mice (Murine)	neutrophils, macrophages, and dendritic cells	TIR domain- containing adaptor protein-inducing IFN-	Q9QUK6.fasta	Q9QUK6	835	triggers the innate immune response and leads to the induction of adaptive immunity	NA	21949773	2011	Pubchem Assay
PRRID_0942	Pam2CSK4 Click for more detail	NA	CCCCCCCCCCCCCCCC(=O)OCC(CSCC(C(=O)NC(CO)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)O)N)OC(=O)CCCCCCCCCCCCCCC	NA	diacylated lipopeptide	Synthetic	Bacterial lipoproteins are strong immune modulators that activate early innate host responses after infection	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice	NA	intracellular TIR domains	Q9QUN7.fasta	Q9QUN7	784	fundamental role in pathogen recognition and activation of innate immunity	NA	21959264	2011	Pubchem Assay
PRRID_0942	Pam2CSK4 Click for more detail	NA	CCCCCCCCCCCCCCCC(=O)OCC(CSCC(C(=O)NC(CO)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)O)N)OC(=O)CCCCCCCCCCCCCCC	NA	diacylated lipopeptide	Synthetic	Bacterial lipoproteins are strong immune modulators that activate early innate host responses after infection	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice	NA	intracellular TIR domains	Q9QUN7.fasta	Q9QUN7	784	fundamental role in pathogen recognition and activation of innate immunity	NA	21959264	2011	Pubchem Assay
PRRID_0945	Pam3CSK4 Click for more detail	Bacteria	CCCCCCCCCCCCCCCC(=O)NC(CSCC(COC(=O)CCCCCCCCCCCCCCC)OC(=O)CCCCCCCCCCCCCCC)C(=O)NC(CO)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)O	NA	Lipoprotein	Synthetic	Mimics the acylated amino terminus of bacterial LPs and is a potent activator of the proinflammatory transcription factor NF-Œ∫B.	Toll-like receptor (TLR1/Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice	NA	intracellular TIR domains	NA	NA	NA	TLR2 is involved in the specific recognition of a wide range of ligands, either as a homodimer or as a heterodimer with TLR1 or TLR6	NA	21959264	2011	NA
PRRID_0945	Pam3CSK4 Click for more detail	Bacteria	CCCCCCCCCCCCCCCC(=O)NC(CSCC(COC(=O)CCCCCCCCCCCCCCC)OC(=O)CCCCCCCCCCCCCCC)C(=O)NC(CO)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)O	NA	Lipoprotein	Synthetic	Mimics the acylated amino terminus of bacterial LPs and is a potent activator of the proinflammatory transcription factor NF-Œ∫B.	Toll-like receptor (TLR1/Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice	NA	intracellular TIR domains	NA	NA	NA	TLR2 is involved in the specific recognition of a wide range of ligands, either as a homodimer or as a heterodimer with TLR1 or TLR6	NA	21959264	2011	NA
PRRID_0983	CBLB613 Click for more detail	Mycoplasma (Bacteria)	NA	NA	Lipopeptides	Natural	reduced radiation-induced cytopenia and increased bone marrow cellularity in irradiated mice	Toll-like receptor 2/6 (TLR2/6)	Toll-like receptor (TLR)	CD2F1 Mice	NA	Leucine-rich Repeat (LRR) Domain	NA	NA	NA	NA	NA	22175300	2012	NA
PRRID_0983	CBLB613 Click for more detail	Mycoplasma (Bacteria)	NA	NA	Lipopeptides	Natural	reduced radiation-induced cytopenia and increased bone marrow cellularity in irradiated mice	Toll-like receptor 2/6 (TLR2/6)	Toll-like receptor (TLR)	CD2F1 Mice	NA	Leucine-rich Repeat (LRR) Domain	NA	NA	NA	NA	NA	22175300	2012	NA
PRRID_1021	ATP Click for more detail	NA	C1=NC2=C(C(=N1)N)N=CN2C3C(C(C(O3)COP(=O)(O)OP(=O)(O)OP(=O)(O)O)O)O	NA	Damage-associated molecular patterns (DAMPs)	Natural	triggers immune responses	Nod-like receptor protein 3 (P2X7R) (NLRP3 (P2X7R)	NOD-like receptor (NLR)	Mice	graft-versus-host disease (GVHD)	NA	Q8BHB0.fasta	Q8BHB0	953	Blockade of ATP-P2X7R signaling pathways decreased acute GVHD	NA	23985302	2013	Pubchem Assay
PRRID_1021	ATP Click for more detail	NA	C1=NC2=C(C(=N1)N)N=CN2C3C(C(C(O3)COP(=O)(O)OP(=O)(O)OP(=O)(O)O)O)O	NA	Damage-associated molecular patterns (DAMPs)	Natural	triggers immune responses	Nod-like receptor protein 3 (P2X7R) (NLRP3 (P2X7R)	NOD-like receptor (NLR)	Mice	graft-versus-host disease (GVHD)	NA	Q8BHB0.fasta	Q8BHB0	953	Blockade of ATP-P2X7R signaling pathways decreased acute GVHD	NA	23985302	2013	Pubchem Assay
PRRID_1025	Bacterial RNA Click for more detail	Bacteria	NA	NA	Nucleic Acid	Natural	elicit innate immune response	Toll-like receptor 13 (TLR13)	Toll-like receptor (TLR)	Mice	NA	NA	Q6R5N8.fasta	Q6R5N8	991	NA	NA	23985302	2013	Pubchem Assay
PRRID_1025	Bacterial RNA Click for more detail	Bacteria	NA	NA	Nucleic Acid	Natural	elicit innate immune response	Toll-like receptor 13 (TLR13)	Toll-like receptor (TLR)	Mice	NA	NA	Q6R5N8.fasta	Q6R5N8	991	NA	NA	23985302	2013	Pubchem Assay
PRRID_1026	Bropirimine Click for more detail	NA	C1=CC=C(C=C1)C2=C(C(=O)N=C(N2)N)Br	NA	Pattern-associated molecular patterns (PAMPs)	Synthetic	experimental drug with¬†anti-cancer¬†and¬†antiviral¬†properties	Toll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Mice	monocyte/macrophages, plasmacytoid DCs and B-lymphocytes	Cell Compartment/Intracellular (Endosome)	P58681.fasta	P58681	1050	important role in the immune response to viral infection	NA	23985302	2013	Pubchem Assay
PRRID_1026	Bropirimine Click for more detail	NA	C1=CC=C(C=C1)C2=C(C(=O)N=C(N2)N)Br	NA	Pattern-associated molecular patterns (PAMPs)	Synthetic	experimental drug with¬†anti-cancer¬†and¬†antiviral¬†properties	Toll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Mice	monocyte/macrophages, plasmacytoid DCs and B-lymphocytes	Cell Compartment/Intracellular (Endosome)	P58681.fasta	P58681	1050	important role in the immune response to viral infection	NA	23985302	2013	Pubchem Assay
PRRID_1027	cytosine-phosphorothioate-guanine oligodeoxynucleotides (CpG ODNs) Click for more detail	Bacteria	NA	NA	Nucleic Acid	Synthetic	mimic bacterial and viral DNA and was also shown to be involved in GVHD	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Mice	graft-versus-host disease (GVHD)	NA	Q9NR96.fasta	Q9NR96	1032	induces pro-inflammatory cytokine response	NA	23985302	2013	Pubchem Assay
PRRID_1027	cytosine-phosphorothioate-guanine oligodeoxynucleotides (CpG ODNs) Click for more detail	Bacteria	NA	NA	Nucleic Acid	Synthetic	mimic bacterial and viral DNA and was also shown to be involved in GVHD	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Mice	graft-versus-host disease (GVHD)	NA	Q9NR96.fasta	Q9NR96	1032	induces pro-inflammatory cytokine response	NA	23985302	2013	Pubchem Assay
PRRID_1029	DNA (immune complexes) Click for more detail	Endogenous (others)	NA	NA	Nucleic Acid	Natural	triggers immune responses	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Mice	monocyte/macrophages, plasmacytoid DCs and B-lymphocytes	Cell Compartment/Intracellular (Endosome)	Q9NR96.fasta	Q9NR96	1032	induces pro-inflammatory cytokine response	NA	23985302	2013	Pubchem Assay
PRRID_1029	DNA (immune complexes) Click for more detail	Endogenous (others)	NA	NA	Nucleic Acid	Natural	triggers immune responses	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Mice	monocyte/macrophages, plasmacytoid DCs and B-lymphocytes	Cell Compartment/Intracellular (Endosome)	Q9NR96.fasta	Q9NR96	1032	induces pro-inflammatory cytokine response	NA	23985302	2013	Pubchem Assay

previous 1 2 3 456 7 8 9...28 29 next