Browse result page of PRRDB 2.0
| PRRID | Name of Ligand | Source of ligand | Sequence of Ligand | Length of Ligand | Type of Ligand | Occurence | Role of Ligand | Name of Receptor | Type of Reeptor | Source of the Receptor | Localization | Domain | Sequence of Receptor | Swiss prot ID | Length of receptor | Function of Receptor | Assay used | PMID | Year of publication | Pubchem assay |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| PRRID_0697 | MxiI Click for more detail | Shigella flexneri (Bacteria) | MNYIYPVNQVDIIKASDFQSQEISSLEDVVSAKYSDIKMDTDIQVSQIMEMVSNPESLNPESLAKLQTTLSNYSIGVSLAGTLARKTVSAVETLLKS | 97 | Protein | Natural | It activates caspase-1 through NLRC4 and secrete IL-1β | Nod-like receptor C4 (NLRC4) | NOD-like receptor (NLR) | Mice | Bone marrow–derived macrophages | NA | Q3UP24.fasta | Q3UP24 | 1024 | It leads to the clearance of the pathogen from the system | ELISA | 20133635 | 2010 | Pubchem Assay |
| PRRID_0697 | MxiI Click for more detail | Shigella flexneri (Bacteria) | MNYIYPVNQVDIIKASDFQSQEISSLEDVVSAKYSDIKMDTDIQVSQIMEMVSNPESLNPESLAKLQTTLSNYSIGVSLAGTLARKTVSAVETLLKS | 97 | Protein | Natural | It activates caspase-1 through NLRC4 and secrete IL-1β | Nod-like receptor C4 (NLRC4) | NOD-like receptor (NLR) | Mice | Bone marrow–derived macrophages | NA | Q3UP24.fasta | Q3UP24 | 1024 | It leads to the clearance of the pathogen from the system | ELISA | 20133635 | 2010 | Pubchem Assay |
| PRRID_0701 | NA Click for more detail | Acanthocheilonema viteae(others) | NA | NA | Pattern-associated molecular patterns (PAMPs) | Natural | NA | Scavenger receptor class A | Scavenger receptor (SR) | Mice | lamina propria macrophage | NA | Q08857.fasta | Q08857 | 472 | It protect against microbial induced pregnancy loss | NA | 20711846 | 2010 | Pubchem Assay |
| PRRID_0701 | NA Click for more detail | Acanthocheilonema viteae(others) | NA | NA | Pattern-associated molecular patterns (PAMPs) | Natural | NA | Scavenger receptor class A | Scavenger receptor (SR) | Mice | lamina propria macrophage | NA | Q08857.fasta | Q08857 | 472 | It protect against microbial induced pregnancy loss | NA | 20711846 | 2010 | Pubchem Assay |
| PRRID_0702 | NA Click for more detail | Acanthocheilonema viteae(others) | NA | NA | Pattern-associated molecular patterns (PAMPs) | Natural | NA | Scavenger receptor class A | Scavenger receptor (SR) | Mice | lamina propria macrophage | NA | Q08857.fasta | Q08857 | 472 | It protect against microbial induced pregnancy loss | NA | 20711846 | 2010 | Pubchem Assay |
| PRRID_0702 | NA Click for more detail | Acanthocheilonema viteae(others) | NA | NA | Pattern-associated molecular patterns (PAMPs) | Natural | NA | Scavenger receptor class A | Scavenger receptor (SR) | Mice | lamina propria macrophage | NA | Q08857.fasta | Q08857 | 472 | It protect against microbial induced pregnancy loss | NA | 20711846 | 2010 | Pubchem Assay |
| PRRID_0723 | Pam3CSK4 Click for more detail | Bacteria | CCCCCCCCCCCCCCCC(=O)NC(CSCC(COC(=O)CCCCCCCCCCCCCCC)OC(=O)CCCCCCCCCCCCCCC)C(=O)NC(CO)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)O | NA | Lipopeptides | Synthetic | Binding of the ligand leads to Akt phosphorylation and activation of the transcription factor NF-κB which results in secretion of proinflammatory cytokines | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Mice | embryonic mouse telencephalon and NPC | Leucine-rich Repeat (LRR) Domain | Q9QUN7.fasta | Q9QUN7 | 784 | its activation inhibits NPC proliferation and decreases cell proliferation. | NA | 20456021 | 2010 | Pubchem Assay |
| PRRID_0723 | Pam3CSK4 Click for more detail | Bacteria | CCCCCCCCCCCCCCCC(=O)NC(CSCC(COC(=O)CCCCCCCCCCCCCCC)OC(=O)CCCCCCCCCCCCCCC)C(=O)NC(CO)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)O | NA | Lipopeptides | Synthetic | Binding of the ligand leads to Akt phosphorylation and activation of the transcription factor NF-κB which results in secretion of proinflammatory cytokines | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Mice | embryonic mouse telencephalon and NPC | Leucine-rich Repeat (LRR) Domain | Q9QUN7.fasta | Q9QUN7 | 784 | its activation inhibits NPC proliferation and decreases cell proliferation. | NA | 20456021 | 2010 | Pubchem Assay |
| PRRID_0724 | Pam3CSK4 Click for more detail | Bacteria | CCCCCCCCCCCCCCCC(=O)NC(CSCC(COC(=O)CCCCCCCCCCCCCCC)OC(=O)CCCCCCCCCCCCCCC)C(=O)NC(CO)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)O | NA | Lipopeptides | Synthetic | It mediates the effect through a TLR2/PI3K/Aktdependent mechanism. | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Mice | Heart | Leucine-rich Repeat (LRR) Domain | Q9QUN7.fasta | Q9QUN7 | 784 | It induces induce cardioprotection against ischaemia/reperfusion injury | EMSA | 20421349 | 2010 | Pubchem Assay |
| PRRID_0724 | Pam3CSK4 Click for more detail | Bacteria | CCCCCCCCCCCCCCCC(=O)NC(CSCC(COC(=O)CCCCCCCCCCCCCCC)OC(=O)CCCCCCCCCCCCCCC)C(=O)NC(CO)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)O | NA | Lipopeptides | Synthetic | It mediates the effect through a TLR2/PI3K/Aktdependent mechanism. | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Mice | Heart | Leucine-rich Repeat (LRR) Domain | Q9QUN7.fasta | Q9QUN7 | 784 | It induces induce cardioprotection against ischaemia/reperfusion injury | EMSA | 20421349 | 2010 | Pubchem Assay |
| PRRID_0727 | Pam3CysSK4 Click for more detail | Bacteria | CCCCCCCCCCCCCCCC(=O)NC(CSCC(COC(=O)CCCCCCCCCCCCCCC)OC(=O)CCCCCCCCCCCCCCC)C(=O)NC(CO)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)O | NA | Peptidoglycan | Synthetic | NA | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Mice (Murine) | Macropahges | Leucine-rich Repeat (LRR) Domain | Q9QUN7.fasta | Q9QUN7 | 784 | Helps in IgM production and clear pathogen from blood | NA | 20696824 | 2010 | Pubchem Assay |
| PRRID_0727 | Pam3CysSK4 Click for more detail | Bacteria | CCCCCCCCCCCCCCCC(=O)NC(CSCC(COC(=O)CCCCCCCCCCCCCCC)OC(=O)CCCCCCCCCCCCCCC)C(=O)NC(CO)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)O | NA | Peptidoglycan | Synthetic | NA | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Mice (Murine) | Macropahges | Leucine-rich Repeat (LRR) Domain | Q9QUN7.fasta | Q9QUN7 | 784 | Helps in IgM production and clear pathogen from blood | NA | 20696824 | 2010 | Pubchem Assay |
| PRRID_0732 | Peptidoglycan (PGN) Click for more detail | Gram-positive bacteria | CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N | NA | Peptidoglycan | Natural | NA | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Mice | Microglia | Leucine-rich Repeat (LRR) Domain | Q9QUN7.fasta | Q9QUN7 | 784 | It boosted the ingestion of Alzheimer’s disease neurotoxic Amyloid β (Aβ) protein in vitro | NA | 20706642 | 2010 | Pubchem Assay |
| PRRID_0732 | Peptidoglycan (PGN) Click for more detail | Gram-positive bacteria | CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N | NA | Peptidoglycan | Natural | NA | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Mice | Microglia | Leucine-rich Repeat (LRR) Domain | Q9QUN7.fasta | Q9QUN7 | 784 | It boosted the ingestion of Alzheimer’s disease neurotoxic Amyloid β (Aβ) protein in vitro | NA | 20706642 | 2010 | Pubchem Assay |
| PRRID_0733 | Peptidoglycan (PGN) Click for more detail | E. coli K12(Bacteria) | CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N | NA | Peptidoglycan | Natural | NA | Nucleotide Binding Oligomerization Domain Containing 2 (Nod2) | NOD-like receptor (NLR) | Mice (Murine) | Macropahges | NA | Q8K3Z0.fasta | Q8K3Z0 | 1020 | NA | NA | 20696824 | 2010 | Pubchem Assay |
| PRRID_0733 | Peptidoglycan (PGN) Click for more detail | E. coli K12(Bacteria) | CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N | NA | Peptidoglycan | Natural | NA | Nucleotide Binding Oligomerization Domain Containing 2 (Nod2) | NOD-like receptor (NLR) | Mice (Murine) | Macropahges | NA | Q8K3Z0.fasta | Q8K3Z0 | 1020 | NA | NA | 20696824 | 2010 | Pubchem Assay |
| PRRID_0737 | Peptidoglycan (PGN) Click for more detail | S. aureus (Bacteria) | CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N | NA | Peptidoglycan | Natural | PGN induced iNOS, COX-2 and proinflammatory cytokine expression was mediated through the TLR2/MyD88/PI3-kinase/AKT pathway, which in turn initiates IKKα/β and NF-κB. | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Mice (Murine) | Microglial cells | Leucine-rich Repeat (LRR) Domain | Q9QUN7.fasta | Q9QUN7 | 784 | It enhances proinflammatory cytokine expression | Transfection and reporter gene assay | 20451669 | 2010 | Pubchem Assay |
| PRRID_0737 | Peptidoglycan (PGN) Click for more detail | S. aureus (Bacteria) | CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N | NA | Peptidoglycan | Natural | PGN induced iNOS, COX-2 and proinflammatory cytokine expression was mediated through the TLR2/MyD88/PI3-kinase/AKT pathway, which in turn initiates IKKα/β and NF-κB. | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Mice (Murine) | Microglial cells | Leucine-rich Repeat (LRR) Domain | Q9QUN7.fasta | Q9QUN7 | 784 | It enhances proinflammatory cytokine expression | Transfection and reporter gene assay | 20451669 | 2010 | Pubchem Assay |
| PRRID_0738 | Peptidoglycan (PGN) Click for more detail | Borrelia burgdorferi(Bacteria) | CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N | NA | Peptidoglycan | Natural | Peptidoglycans are recognized by active NOD2 molecules and the adaptor molecule RICK is recruited, which ultimately leads to activation of NF-kB and transcription of cytokines | Nucleotide Binding Oligomerization Domain Containing 2 (Nod2) | NOD-like receptor (NLR) | Mice | PBMCs | NA | Q8K3Z0.fasta | Q8K3Z0 | 1020 | It aids in the induction of inflammtory reaction against Borrelia burgdorferi | ELISA | 20441518 | 2010 | Pubchem Assay |
| PRRID_0738 | Peptidoglycan (PGN) Click for more detail | Borrelia burgdorferi(Bacteria) | CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N | NA | Peptidoglycan | Natural | Peptidoglycans are recognized by active NOD2 molecules and the adaptor molecule RICK is recruited, which ultimately leads to activation of NF-kB and transcription of cytokines | Nucleotide Binding Oligomerization Domain Containing 2 (Nod2) | NOD-like receptor (NLR) | Mice | PBMCs | NA | Q8K3Z0.fasta | Q8K3Z0 | 1020 | It aids in the induction of inflammtory reaction against Borrelia burgdorferi | ELISA | 20441518 | 2010 | Pubchem Assay |
| PRRID_0740 | Peptidoglycan (PGN) Click for more detail | Gram-negative bacteria | CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N | NA | Peptidoglycan | Synthetic | It mediates the effect through a TLR2/PI3K/Aktdependent mechanism. | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Mice | Heart | Leucine-rich Repeat (LRR) Domain | Q9QUN7.fasta | Q9QUN7 | 784 | It induces induce cardioprotection against ischaemia/reperfusion injury | EMSA | 20421349 | 2010 | Pubchem Assay |
| PRRID_0740 | Peptidoglycan (PGN) Click for more detail | Gram-negative bacteria | CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N | NA | Peptidoglycan | Synthetic | It mediates the effect through a TLR2/PI3K/Aktdependent mechanism. | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Mice | Heart | Leucine-rich Repeat (LRR) Domain | Q9QUN7.fasta | Q9QUN7 | 784 | It induces induce cardioprotection against ischaemia/reperfusion injury | EMSA | 20421349 | 2010 | Pubchem Assay |
| PRRID_0745 | Peptidoglycan (PGN) Click for more detail | Gram-positive bacteria | CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N | NA | Peptidoglycan | Natural | Augment cytokines and chemokines expression and promoting enhanced PMN transalveolar migration and exaggerated lung inflammation in response to invading pathogens | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Mice | Lung's endothelial cell | Leucine-rich Repeat (LRR) Domain | Q9QUN7.fasta | Q9QUN7 | 784 | It has the role in the inflammation. | NA | 20706658 | 2010 | Pubchem Assay |
| PRRID_0745 | Peptidoglycan (PGN) Click for more detail | Gram-positive bacteria | CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N | NA | Peptidoglycan | Natural | Augment cytokines and chemokines expression and promoting enhanced PMN transalveolar migration and exaggerated lung inflammation in response to invading pathogens | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Mice | Lung's endothelial cell | Leucine-rich Repeat (LRR) Domain | Q9QUN7.fasta | Q9QUN7 | 784 | It has the role in the inflammation. | NA | 20706658 | 2010 | Pubchem Assay |
| PRRID_0746 | PGNmonomer Click for more detail | S. aureus (Bacteria) | CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N | NA | Peptidoglycan | Natural | It initiates the activation of NF- | Nucleotide Binding Oligomerization Domain Containing 2 (Nod2) | NOD-like receptor (NLR) | Mice (Murine) | NA | NA | Q8K3Z0.fasta | Q8K3Z0 | 1020 | It act as potent costimulator of the innate immune system in the presence of TLR signals | Luciferase assay | 20522786 | 2010 | Pubchem Assay |
| PRRID_0746 | PGNmonomer Click for more detail | S. aureus (Bacteria) | CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N | NA | Peptidoglycan | Natural | It initiates the activation of NF- | Nucleotide Binding Oligomerization Domain Containing 2 (Nod2) | NOD-like receptor (NLR) | Mice (Murine) | NA | NA | Q8K3Z0.fasta | Q8K3Z0 | 1020 | It act as potent costimulator of the innate immune system in the presence of TLR signals | Luciferase assay | 20522786 | 2010 | Pubchem Assay |
| PRRID_0747 | PGNpolymer Click for more detail | S. aureus (Bacteria) | CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N | NA | Peptidoglycan | Natural | It initiates the activation of NF- | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Mice | HEK293 | Leucine-rich Repeat (LRR) Domain | Q9QUN7.fasta | Q9QUN7 | 784 | It induced murine dendritic cell (DC) maturation and cytokine production. | Luciferase assay | 20522786 | 2010 | Pubchem Assay |
| PRRID_0747 | PGNpolymer Click for more detail | S. aureus (Bacteria) | CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N | NA | Peptidoglycan | Natural | It initiates the activation of NF- | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Mice | HEK293 | Leucine-rich Repeat (LRR) Domain | Q9QUN7.fasta | Q9QUN7 | 784 | It induced murine dendritic cell (DC) maturation and cytokine production. | Luciferase assay | 20522786 | 2010 | Pubchem Assay |
| PRRID_0748 | phenol-soluble modulin Click for more detail | Staphylococcus epidermis (Bacteria) | MSKLAEAIANTVKAAQDQDWTKLGTSIVDIVESGVSVLGKIFGF | 44 | Protein | Natural | Increases expression of macrophage inflammatory protein-2 , cytokine migration inhibitory factor (MIF), and TNF-α and induces augment PMN migration. | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Mice | Lung's endothelial cell | Leucine-rich Repeat (LRR) Domain | Q9QUN7.fasta | Q9QUN7 | 784 | It has the role in the inflammation. | NA | 20706658 | 2010 | Pubchem Assay |
| PRRID_0748 | phenol-soluble modulin Click for more detail | Staphylococcus epidermis (Bacteria) | MSKLAEAIANTVKAAQDQDWTKLGTSIVDIVESGVSVLGKIFGF | 44 | Protein | Natural | Increases expression of macrophage inflammatory protein-2 , cytokine migration inhibitory factor (MIF), and TNF-α and induces augment PMN migration. | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Mice | Lung's endothelial cell | Leucine-rich Repeat (LRR) Domain | Q9QUN7.fasta | Q9QUN7 | 784 | It has the role in the inflammation. | NA | 20706658 | 2010 | Pubchem Assay |
| PRRID_0757 | polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail | NA | C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O | NA | Nucleic Acid | Synthetic | enhance the efficacy of peptide-based cancer vaccines by promoting tumor specific T cell responses | Toll-like receptor 3 (TLR3) | Toll-like receptor (TLR) | Mice (Murine) | dendritic cells and macrophages | Leucine-rich Repeat (LRR) Domain | Q99MB1.fasta | Q99MB1 | 905 | It has the role in the inflammation. | NA | 20713100 | 2010 | Pubchem Assay |
| PRRID_0757 | polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail | NA | C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O | NA | Nucleic Acid | Synthetic | enhance the efficacy of peptide-based cancer vaccines by promoting tumor specific T cell responses | Toll-like receptor 3 (TLR3) | Toll-like receptor (TLR) | Mice (Murine) | dendritic cells and macrophages | Leucine-rich Repeat (LRR) Domain | Q99MB1.fasta | Q99MB1 | 905 | It has the role in the inflammation. | NA | 20713100 | 2010 | Pubchem Assay |
| PRRID_0768 | polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail | NA | C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O | NA | Nucleic Acid | Synthetic | It stimulates the release of TNF-‚ç∫, IL-6 and CXCL1, and nitric oxide by microglia | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Mice (Murine) | Primary Microglial cells | Leucine-rich Repeat (LRR) Domain | Q9QUK6.fasta | Q9QUK6 | 835 | Poly(I:C) increases microglial phagocytosis and intracellular killing of Escherichia coli K1, a pathogenic encapsulated bacterial strain | Phagocytosis assay | 20599470 | 2010 | Pubchem Assay |
| PRRID_0768 | polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail | NA | C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O | NA | Nucleic Acid | Synthetic | It stimulates the release of TNF-‚ç∫, IL-6 and CXCL1, and nitric oxide by microglia | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Mice (Murine) | Primary Microglial cells | Leucine-rich Repeat (LRR) Domain | Q9QUK6.fasta | Q9QUK6 | 835 | Poly(I:C) increases microglial phagocytosis and intracellular killing of Escherichia coli K1, a pathogenic encapsulated bacterial strain | Phagocytosis assay | 20599470 | 2010 | Pubchem Assay |
| PRRID_0773 | polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail | NA | C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O | NA | Nucleic Acid | Synthetic | It induces the release of microparticles by the macrophages | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Mice (Murine) | Macropahes | LRR | Q9QUK6.fasta | Q9QUK6 | 835 | It leads to the release of MPs which act as the novel signals for innate immunity | Griess assay | 20335312 | 2010 | Pubchem Assay |
| PRRID_0773 | polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail | NA | C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O | NA | Nucleic Acid | Synthetic | It induces the release of microparticles by the macrophages | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Mice (Murine) | Macropahes | LRR | Q9QUK6.fasta | Q9QUK6 | 835 | It leads to the release of MPs which act as the novel signals for innate immunity | Griess assay | 20335312 | 2010 | Pubchem Assay |
| PRRID_0774 | Polyporus polysaccharide Click for more detail | NA | NA | NA | Carbohydrate | Natural | enhanced cell-surface expression of CD86 and production of both interleukin (IL)-12p40 and IL-10 | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Mice (Murine) | bone derived dendritic cells | Leucine-rich Repeat (LRR) Domain | Q9QUK6.fasta | Q9QUK6 | 835 | It involved in BMDCs maturation by inducing phenotypic and functional hanges | ELISA | 20673883 | 2010 | Pubchem Assay |
| PRRID_0774 | Polyporus polysaccharide Click for more detail | NA | NA | NA | Carbohydrate | Natural | enhanced cell-surface expression of CD86 and production of both interleukin (IL)-12p40 and IL-10 | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Mice (Murine) | bone derived dendritic cells | Leucine-rich Repeat (LRR) Domain | Q9QUK6.fasta | Q9QUK6 | 835 | It involved in BMDCs maturation by inducing phenotypic and functional hanges | ELISA | 20673883 | 2010 | Pubchem Assay |
| PRRID_0777 | PrgJ Click for more detail | S. typhimurium (Bacteria) | MSIATIVPENAVIGQAVNIRSMETDIVSLDDRLLQAFSGSAIATAVDKQTITNRIEDPNLVTDPKELAISQEMISDYNLYVSMVSTLTRKGVGAVETLLRS | 101 | Protein | Natural | It activates caspase-1 through NLRC4 and secrete IL-1β | Nod-like receptor C4 (NLRC4) | NOD-like receptor (NLR) | Mice | Bone marrow–derived macrophages | NA | Q3UP24.fasta | Q3UP24 | 1024 | It leads to the clearance of the pathogen from the system | ELISA | 20133635 | 2010 | Pubchem Assay |
| PRRID_0777 | PrgJ Click for more detail | S. typhimurium (Bacteria) | MSIATIVPENAVIGQAVNIRSMETDIVSLDDRLLQAFSGSAIATAVDKQTITNRIEDPNLVTDPKELAISQEMISDYNLYVSMVSTLTRKGVGAVETLLRS | 101 | Protein | Natural | It activates caspase-1 through NLRC4 and secrete IL-1β | Nod-like receptor C4 (NLRC4) | NOD-like receptor (NLR) | Mice | Bone marrow–derived macrophages | NA | Q3UP24.fasta | Q3UP24 | 1024 | It leads to the clearance of the pathogen from the system | ELISA | 20133635 | 2010 | Pubchem Assay |
| PRRID_0779 | PS-G Click for more detail | Ganoderma lucidum (fungi) | NA | NA | Carbohydrate | Natural | Binding resulted into the activation of NF- | Toll-like receptor 5 (TLR5) | Toll-like receptor (TLR) | Mice (Murine) | bone derived dendritic cells | Leucine-rich Repeat (LRR) Domain | Q9JLF7.fasta | Q9JLF7 | 859 | promote the activation and maturation of BMDCs and macrophages | NA | 20673883 | 2010 | Pubchem Assay |
| PRRID_0779 | PS-G Click for more detail | Ganoderma lucidum (fungi) | NA | NA | Carbohydrate | Natural | Binding resulted into the activation of NF- | Toll-like receptor 5 (TLR5) | Toll-like receptor (TLR) | Mice (Murine) | bone derived dendritic cells | Leucine-rich Repeat (LRR) Domain | Q9JLF7.fasta | Q9JLF7 | 859 | promote the activation and maturation of BMDCs and macrophages | NA | 20673883 | 2010 | Pubchem Assay |
| PRRID_0780 | PscI Click for more detail | Pseudomonas aeruginosa (Bacteria) | MDISRMGAQAQITSLEELSGGPAGAAHVAEFERAMGGAGSLGGDLLSELGQIRERFSQAKQELQMELSTPGDDPNSLMQMQWSLMRITMQEELIAKTVGRMSQNVETLMKTQ | 112 | Protein | Natural | It activates caspase-1 through NLRC4 and secrete IL-1β | Nod-like receptor C4 (NLRC4) | NOD-like receptor (NLR) | Mice | Bone marrow–derived macrophages | NA | Q3UP24.fasta | Q3UP24 | 1024 | It leads to the clearance of the pathogen from the system | ELISA | 20133635 | 2010 | Pubchem Assay |
| PRRID_0780 | PscI Click for more detail | Pseudomonas aeruginosa (Bacteria) | MDISRMGAQAQITSLEELSGGPAGAAHVAEFERAMGGAGSLGGDLLSELGQIRERFSQAKQELQMELSTPGDDPNSLMQMQWSLMRITMQEELIAKTVGRMSQNVETLMKTQ | 112 | Protein | Natural | It activates caspase-1 through NLRC4 and secrete IL-1β | Nod-like receptor C4 (NLRC4) | NOD-like receptor (NLR) | Mice | Bone marrow–derived macrophages | NA | Q3UP24.fasta | Q3UP24 | 1024 | It leads to the clearance of the pathogen from the system | ELISA | 20133635 | 2010 | Pubchem Assay |
| PRRID_0784 | rlipo-D1E3 Click for more detail | Dengue virus(virus) | NA | NA | Recombinant lipoprotein | Synthetic | It activated the NF- | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Mice | Spleen cells and Bone-Marrow derived dendritic cells | Leucine-rich Repeat (LRR) Domain | Q9QUN7.fasta | Q9QUN7 | 784 | It promote various immune responses by inducing different levels of biological cytokines and chemokines. | NF- | 20478617 | 2010 | Pubchem Assay |
| PRRID_0784 | rlipo-D1E3 Click for more detail | Dengue virus(virus) | NA | NA | Recombinant lipoprotein | Synthetic | It activated the NF- | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Mice | Spleen cells and Bone-Marrow derived dendritic cells | Leucine-rich Repeat (LRR) Domain | Q9QUN7.fasta | Q9QUN7 | 784 | It promote various immune responses by inducing different levels of biological cytokines and chemokines. | NF- | 20478617 | 2010 | Pubchem Assay |
| PRRID_0786 | S-[2,3-bispalmitoyiloxy-(2R)-propyl]- R-cysteinyl-amido-monomethoxyl polyethylene glycol (BPPcysMPEG Click for more detail | NA | NA | NA | Adjuvant | Synthetic | It activates the TLR2/6 heterodimer. | Toll-like receptor 2/6 (TLR2/6) | Toll-like receptor (TLR) | Mice | Dendritic cells | NA | NA | NA | NA | It leads to efficient cross-priming against co-administered and linked antigens. | Cytotoxicity assay | 20213735 | 2010 | NA |
| PRRID_0786 | S-[2,3-bispalmitoyiloxy-(2R)-propyl]- R-cysteinyl-amido-monomethoxyl polyethylene glycol (BPPcysMPEG Click for more detail | NA | NA | NA | Adjuvant | Synthetic | It activates the TLR2/6 heterodimer. | Toll-like receptor 2/6 (TLR2/6) | Toll-like receptor (TLR) | Mice | Dendritic cells | NA | NA | NA | NA | It leads to efficient cross-priming against co-administered and linked antigens. | Cytotoxicity assay | 20213735 | 2010 | NA |
| PRRID_0789 | SE-derived secreted factor (SE-S) Click for more detail | Staphylococcus epidermidis strain 1457 (Bacteria) | MNYSKITVTLIIILLCTFSFEFSFNRFVQADESRPKIESLKKKSELDSTALYNIKTSYSQDNIILDIKNKTNSTQLLSNDLIFDDITLKEWNKNSLKTEFNSSEIANHFKGKKVDIFGIYYGANCIGEVSKRTGCIYGGITLHEEEKIDQKNSIGVNVFKDGSQQKGFMITTDKKEPTIQELDLKTRKVIQNQYKIYNSETGNIQKGYMEFHSNSSSFYYDLFNFKGKYSVDFLKFYNDNKTINSSNLHIDVYLYSQ | 257 | Soluble factor | Natural | TLR2 mediated SE-induced cytokine production such as TNF, CXCL1 and CXCL2 | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Mice | human embryonic kidney cells, human whole blood and murine primary macrophages | Leucine-rich Repeat (LRR) Domain | Q99MB1.fasta | Q99MB1 | 905 | TLR2 mediates recognition of live SE and clearance of SE bacteremia. | Cytokines assay | 20404927 | 2010 | Pubchem Assay |
| PRRID_0789 | SE-derived secreted factor (SE-S) Click for more detail | Staphylococcus epidermidis strain 1457 (Bacteria) | MNYSKITVTLIIILLCTFSFEFSFNRFVQADESRPKIESLKKKSELDSTALYNIKTSYSQDNIILDIKNKTNSTQLLSNDLIFDDITLKEWNKNSLKTEFNSSEIANHFKGKKVDIFGIYYGANCIGEVSKRTGCIYGGITLHEEEKIDQKNSIGVNVFKDGSQQKGFMITTDKKEPTIQELDLKTRKVIQNQYKIYNSETGNIQKGYMEFHSNSSSFYYDLFNFKGKYSVDFLKFYNDNKTINSSNLHIDVYLYSQ | 257 | Soluble factor | Natural | TLR2 mediated SE-induced cytokine production such as TNF, CXCL1 and CXCL2 | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Mice | human embryonic kidney cells, human whole blood and murine primary macrophages | Leucine-rich Repeat (LRR) Domain | Q99MB1.fasta | Q99MB1 | 905 | TLR2 mediates recognition of live SE and clearance of SE bacteremia. | Cytokines assay | 20404927 | 2010 | Pubchem Assay |
| PRRID_0792 | single-stranded RNA Click for more detail | Virus | NA | NA | Nucleic Acid | Natural | release of proinflammatory cytokines and Pathgen Clearance | Toll-like receptor 7 (TLR7) | Toll-like receptor (TLR) | Mice | NA | Leucine-rich Repeat (LRR) Domain | P58681.fasta | P58681 | 1050 | It has the role in the inflammation. | NA | 20739362 | 2010 | Pubchem Assay |
| PRRID_0792 | single-stranded RNA Click for more detail | Virus | NA | NA | Nucleic Acid | Natural | release of proinflammatory cytokines and Pathgen Clearance | Toll-like receptor 7 (TLR7) | Toll-like receptor (TLR) | Mice | NA | Leucine-rich Repeat (LRR) Domain | P58681.fasta | P58681 | 1050 | It has the role in the inflammation. | NA | 20739362 | 2010 | Pubchem Assay |
| PRRID_0805 | sonifilan Click for more detail | Schizophyllum commune (fungi) | C(C1C(C(C(C(O1)O)O)OC2C(C(C(C(O2)COC3C(C(C(C(O3)CO)O)O)O)O)OC4C(C(C(C(O4)CO)O)O)O)O)O)O | NA | Biological response modifiers (BRMs) | Natural | Medicinal properties | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Mice | dendritic cells and macrophages | Leucine-rich Repeat (LRR) Domain | Q9QUK6.fasta | Q9QUK6 | 835 | used clinically for cancer therapy | NA | 20699131 | 2010 | Pubchem Assay |
| PRRID_0805 | sonifilan Click for more detail | Schizophyllum commune (fungi) | C(C1C(C(C(C(O1)O)O)OC2C(C(C(C(O2)COC3C(C(C(C(O3)CO)O)O)O)O)OC4C(C(C(C(O4)CO)O)O)O)O)O)O | NA | Biological response modifiers (BRMs) | Natural | Medicinal properties | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Mice | dendritic cells and macrophages | Leucine-rich Repeat (LRR) Domain | Q9QUK6.fasta | Q9QUK6 | 835 | used clinically for cancer therapy | NA | 20699131 | 2010 | Pubchem Assay |
| PRRID_0809 | SS Rna and CpG DNA Click for more detail | Virus | NA | NA | Nucleic Acid | Natural | NA | Toll-like receptor 9 (TLR9) | Toll-like receptor (TLR) | Mice (Murine) | NA | Leucine-rich Repeat (LRR) Domain | Q9NR96.fasta | Q9NR96 | 1032 | NA | NA | 20739519 | 2010 | Pubchem Assay |
| PRRID_0809 | SS Rna and CpG DNA Click for more detail | Virus | NA | NA | Nucleic Acid | Natural | NA | Toll-like receptor 9 (TLR9) | Toll-like receptor (TLR) | Mice (Murine) | NA | Leucine-rich Repeat (LRR) Domain | Q9NR96.fasta | Q9NR96 | 1032 | NA | NA | 20739519 | 2010 | Pubchem Assay |
| PRRID_0811 | Stathmins Click for more detail | Human (others) | MASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDLSLEEIQKKLEAAEERRKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHIEEVRKNKESKDPADETEAD | 149 | Endogenous | Natural | Binding of stathmins to TLR3 activates downstream signalling pathways via TRIF and lead to the secretion of IL-6 and CXCL-8 | Toll-like receptor 3 (TLR3) | Toll-like receptor (TLR) | Mice (Murine) | Astrocytes and microglia | Leucine-rich Repeat (LRR) Domain | Q99MB1.fasta | Q99MB1 | 905 | It has a role in astrocyte-mediated neuroprotection and in morphogenesis in the CNS | NA | 20483774 | 2010 | Pubchem Assay |
| PRRID_0811 | Stathmins Click for more detail | Human (others) | MASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDLSLEEIQKKLEAAEERRKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHIEEVRKNKESKDPADETEAD | 149 | Endogenous | Natural | Binding of stathmins to TLR3 activates downstream signalling pathways via TRIF and lead to the secretion of IL-6 and CXCL-8 | Toll-like receptor 3 (TLR3) | Toll-like receptor (TLR) | Mice (Murine) | Astrocytes and microglia | Leucine-rich Repeat (LRR) Domain | Q99MB1.fasta | Q99MB1 | 905 | It has a role in astrocyte-mediated neuroprotection and in morphogenesis in the CNS | NA | 20483774 | 2010 | Pubchem Assay |
| PRRID_0812 | Surface structure Click for more detail | Virus | NA | NA | Pattern-associated molecular patterns (PAMPs) | Natural | NA | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Mice (Murine) | NA | Leucine-rich Repeat (LRR) Domain | Q9QUN7.fasta | Q9QUN7 | 784 | NA | NA | 20739519 | 2010 | Pubchem Assay |
| PRRID_0812 | Surface structure Click for more detail | Virus | NA | NA | Pattern-associated molecular patterns (PAMPs) | Natural | NA | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Mice (Murine) | NA | Leucine-rich Repeat (LRR) Domain | Q9QUN7.fasta | Q9QUN7 | 784 | NA | NA | 20739519 | 2010 | Pubchem Assay |
| PRRID_0813 | Surface structure Click for more detail | Virus | NA | NA | Pattern-associated molecular patterns (PAMPs) | Natural | NA | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Mice (Murine) | NA | Leucine-rich Repeat (LRR) Domain | Q9QUK6.fasta | Q9QUK6 | 835 | NA | NA | 20739519 | 2010 | Pubchem Assay |
| PRRID_0813 | Surface structure Click for more detail | Virus | NA | NA | Pattern-associated molecular patterns (PAMPs) | Natural | NA | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Mice (Murine) | NA | Leucine-rich Repeat (LRR) Domain | Q9QUK6.fasta | Q9QUK6 | 835 | NA | NA | 20739519 | 2010 | Pubchem Assay |
| PRRID_0832 | viral envelope proteins Click for more detail | RSV and MMTV (virus) | NA | NA | Nucleic Acid | Natural | NA | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Mice (Murine) | dendritic cells and macrophages | Leucine-rich Repeat (LRR) Domain | Q9QUK6.fasta | Q9QUK6 | 835 | NA | NA | 20713100 | 2010 | Pubchem Assay |
| PRRID_0832 | viral envelope proteins Click for more detail | RSV and MMTV (virus) | NA | NA | Nucleic Acid | Natural | NA | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Mice (Murine) | dendritic cells and macrophages | Leucine-rich Repeat (LRR) Domain | Q9QUK6.fasta | Q9QUK6 | 835 | NA | NA | 20713100 | 2010 | Pubchem Assay |
| PRRID_0839 | Virulence factor p60 Click for more detail | Listeriamonocytogenes (Bacteria) | MKKIMLVFITLILVSLPIAQQTEAKDASAFNKENSISSMAPPASPPASPKTPIEKKHADEIDKYIQGLDYNKNNVLVYHGDAVTNVPPRKGYKDGNEYIVVEKKKKSINQNNADIQVVNAISSLTYPGALVKANSELVENQPDVLPVKRDSLTLSIDLPGMTNQDNKIVVKNATKSNVNNAVNTLVERWNEKYAQAYPNVSAKIDYDDEMAYSESQLIAKFGTAFKAVNNSLNVNFGAISEGKMQEEVISFKQIYYNVNVNEPTRPSRFFGKAVTKEQLQALGVNAENPPAYISSVAYGRQVYLKLSTNSHSTKVKAAFDAAVSGKSVSGDVELTNIIKNSSFKAVIYGGSAKDEVQIIDGNLGDLRDILKKGATFNRETPGVPIAYTTNFLKDNELAVIKNNSEYIETTSKAYTDGKINIDHSGGYVAQFNISWDEVNYDPEGNEIVQHKNWSENNKSKLAHFTSSIYLPGNARNINVYAKECTGLAWEWWRTVIDDRNLPLVKNRNISIWGTTLYPKYSNKVDNPIE | 529 | Protein | Natural | It activates of nuclear factor kB (NF-kB) and induces proinflammatory cytokine production. | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Mice | Macropahes | LRR | Q9QUK6.fasta | Q9QUK6 | 835 | It provides host resistance against infection with L. monocytogenes. | ELISA | 20337701 | 2010 | Pubchem Assay |
| PRRID_0839 | Virulence factor p60 Click for more detail | Listeriamonocytogenes (Bacteria) | MKKIMLVFITLILVSLPIAQQTEAKDASAFNKENSISSMAPPASPPASPKTPIEKKHADEIDKYIQGLDYNKNNVLVYHGDAVTNVPPRKGYKDGNEYIVVEKKKKSINQNNADIQVVNAISSLTYPGALVKANSELVENQPDVLPVKRDSLTLSIDLPGMTNQDNKIVVKNATKSNVNNAVNTLVERWNEKYAQAYPNVSAKIDYDDEMAYSESQLIAKFGTAFKAVNNSLNVNFGAISEGKMQEEVISFKQIYYNVNVNEPTRPSRFFGKAVTKEQLQALGVNAENPPAYISSVAYGRQVYLKLSTNSHSTKVKAAFDAAVSGKSVSGDVELTNIIKNSSFKAVIYGGSAKDEVQIIDGNLGDLRDILKKGATFNRETPGVPIAYTTNFLKDNELAVIKNNSEYIETTSKAYTDGKINIDHSGGYVAQFNISWDEVNYDPEGNEIVQHKNWSENNKSKLAHFTSSIYLPGNARNINVYAKECTGLAWEWWRTVIDDRNLPLVKNRNISIWGTTLYPKYSNKVDNPIE | 529 | Protein | Natural | It activates of nuclear factor kB (NF-kB) and induces proinflammatory cytokine production. | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Mice | Macropahes | LRR | Q9QUK6.fasta | Q9QUK6 | 835 | It provides host resistance against infection with L. monocytogenes. | ELISA | 20337701 | 2010 | Pubchem Assay |
| PRRID_0840 | Virulence factor p60 Click for more detail | Listeriamonocytogenes (Bacteria) | MKKIMLVFITLILVSLPIAQQTEAKDASAFNKENSISSMAPPASPPASPKTPIEKKHADEIDKYIQGLDYNKNNVLVYHGDAVTNVPPRKGYKDGNEYIVVEKKKKSINQNNADIQVVNAISSLTYPGALVKANSELVENQPDVLPVKRDSLTLSIDLPGMTNQDNKIVVKNATKSNVNNAVNTLVERWNEKYAQAYPNVSAKIDYDDEMAYSESQLIAKFGTAFKAVNNSLNVNFGAISEGKMQEEVISFKQIYYNVNVNEPTRPSRFFGKAVTKEQLQALGVNAENPPAYISSVAYGRQVYLKLSTNSHSTKVKAAFDAAVSGKSVSGDVELTNIIKNSSFKAVIYGGSAKDEVQIIDGNLGDLRDILKKGATFNRETPGVPIAYTTNFLKDNELAVIKNNSEYIETTSKAYTDGKINIDHSGGYVAQFNISWDEVNYDPEGNEIVQHKNWSENNKSKLAHFTSSIYLPGNARNINVYAKECTGLAWEWWRTVIDDRNLPLVKNRNISIWGTTLYPKYSNKVDNPIE | 529 | Protein | Natural | It activates of nuclear factor kB (NF-kB) and induces proinflammatory cytokine production. | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Mice | Macrophage RAW264.7 cells | LRR | Q9QUK6.fasta | Q9QUK6 | 835 | It provides host resistance against infection with L. monocytogenes. | ELISA | 20337701 | 2010 | Pubchem Assay |
| PRRID_0840 | Virulence factor p60 Click for more detail | Listeriamonocytogenes (Bacteria) | MKKIMLVFITLILVSLPIAQQTEAKDASAFNKENSISSMAPPASPPASPKTPIEKKHADEIDKYIQGLDYNKNNVLVYHGDAVTNVPPRKGYKDGNEYIVVEKKKKSINQNNADIQVVNAISSLTYPGALVKANSELVENQPDVLPVKRDSLTLSIDLPGMTNQDNKIVVKNATKSNVNNAVNTLVERWNEKYAQAYPNVSAKIDYDDEMAYSESQLIAKFGTAFKAVNNSLNVNFGAISEGKMQEEVISFKQIYYNVNVNEPTRPSRFFGKAVTKEQLQALGVNAENPPAYISSVAYGRQVYLKLSTNSHSTKVKAAFDAAVSGKSVSGDVELTNIIKNSSFKAVIYGGSAKDEVQIIDGNLGDLRDILKKGATFNRETPGVPIAYTTNFLKDNELAVIKNNSEYIETTSKAYTDGKINIDHSGGYVAQFNISWDEVNYDPEGNEIVQHKNWSENNKSKLAHFTSSIYLPGNARNINVYAKECTGLAWEWWRTVIDDRNLPLVKNRNISIWGTTLYPKYSNKVDNPIE | 529 | Protein | Natural | It activates of nuclear factor kB (NF-kB) and induces proinflammatory cytokine production. | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Mice | Macrophage RAW264.7 cells | LRR | Q9QUK6.fasta | Q9QUK6 | 835 | It provides host resistance against infection with L. monocytogenes. | ELISA | 20337701 | 2010 | Pubchem Assay |
| PRRID_0841 | Virus Click for more detail | T. gondii (others) | NA | NA | Pattern-associated molecular patterns (PAMPs) | Natural | It induces Crp-3/-5 production and release by PCs via a TLR9-dependent production of type I IFNs | Toll-like receptor 9 (TLR9) | Toll-like receptor (TLR) | C57BL/6 Mice | epithial cells | Leucine-rich Repeat (LRR) Domain | Q9NR96.fasta | Q9NR96 | 1032 | It affect the early control of T. gondii invasiveness by promoting the initiation of a protective Th1 response against the parasite | NA | 20488791 | 2010 | Pubchem Assay |
| PRRID_0841 | Virus Click for more detail | T. gondii (others) | NA | NA | Pattern-associated molecular patterns (PAMPs) | Natural | It induces Crp-3/-5 production and release by PCs via a TLR9-dependent production of type I IFNs | Toll-like receptor 9 (TLR9) | Toll-like receptor (TLR) | C57BL/6 Mice | epithial cells | Leucine-rich Repeat (LRR) Domain | Q9NR96.fasta | Q9NR96 | 1032 | It affect the early control of T. gondii invasiveness by promoting the initiation of a protective Th1 response against the parasite | NA | 20488791 | 2010 | Pubchem Assay |
| PRRID_0849 | Zymosan Click for more detail | Fungi | C(C1C(C(C(C(O1)O)O)O)O)O | NA | Glucan | Natural | Increases expression of macrophage inflammatory protein-2 , cytokine migration inhibitory factor (MIF), and TNF-α and induces augment PMN migration. | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Mice | Lung's endothelial cell | Leucine-rich Repeat (LRR) Domain | Q9QUN7.fasta | Q9QUN7 | 784 | It has the role in the inflammation. | NA | 20706658 | 2010 | Pubchem Assay |
| PRRID_0849 | Zymosan Click for more detail | Fungi | C(C1C(C(C(C(O1)O)O)O)O)O | NA | Glucan | Natural | Increases expression of macrophage inflammatory protein-2 , cytokine migration inhibitory factor (MIF), and TNF-α and induces augment PMN migration. | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Mice | Lung's endothelial cell | Leucine-rich Repeat (LRR) Domain | Q9QUN7.fasta | Q9QUN7 | 784 | It has the role in the inflammation. | NA | 20706658 | 2010 | Pubchem Assay |
| PRRID_0863 | LTA Click for more detail | Gram-positive bacteria | C(C1C(C(C(C(O1)OCC(CO)O)OC2C(C(C(C(O2)COP(=O)(O)OCC(COP(=O)(O)OCC(COP(=O)(O)OCC(COP(=O)(O)OCC(CO)O)O)O)O)O)O)O)O)O)O | NA | Pattern-associated molecular patterns (PAMPs) | Natural | Augment cytokines and chemokines expression and promoting enhanced PMN transalveolar migration and exaggerated lung inflammation in response to invading pathogens | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Mice | Lung's endothelial cell | Leucine-rich Repeat (LRR) Domain | Q9QUN7.fasta | Q9QUN7 | 784 | It has the role in the inflammation. | NA | 20706658 | 2010 | Pubchem Assay |
| PRRID_0863 | LTA Click for more detail | Gram-positive bacteria | C(C1C(C(C(C(O1)OCC(CO)O)OC2C(C(C(C(O2)COP(=O)(O)OCC(COP(=O)(O)OCC(COP(=O)(O)OCC(COP(=O)(O)OCC(CO)O)O)O)O)O)O)O)O)O)O | NA | Pattern-associated molecular patterns (PAMPs) | Natural | Augment cytokines and chemokines expression and promoting enhanced PMN transalveolar migration and exaggerated lung inflammation in response to invading pathogens | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Mice | Lung's endothelial cell | Leucine-rich Repeat (LRR) Domain | Q9QUN7.fasta | Q9QUN7 | 784 | It has the role in the inflammation. | NA | 20706658 | 2010 | Pubchem Assay |
| PRRID_0879 | dsRNA Click for more detail | Virus | NA | NA | Nucleic Acid | Natural | triggers immune responses | Toll-like receptor 3 (TLR3) | Toll-like receptor (TLR) | Mice | NA | intracellular TIR domains | Q99MB1.fasta | Q99MB1 | 905 | TLR3 ligands induced the release of both proinflammatory cytokines [interleukin (IL)-6 and IL-8] and type I interferon by nmMSCs compared with other TLR ligands | NA | 21959264 | 2011 | Pubchem Assay |
| PRRID_0879 | dsRNA Click for more detail | Virus | NA | NA | Nucleic Acid | Natural | triggers immune responses | Toll-like receptor 3 (TLR3) | Toll-like receptor (TLR) | Mice | NA | intracellular TIR domains | Q99MB1.fasta | Q99MB1 | 905 | TLR3 ligands induced the release of both proinflammatory cytokines [interleukin (IL)-6 and IL-8] and type I interferon by nmMSCs compared with other TLR ligands | NA | 21959264 | 2011 | Pubchem Assay |
| PRRID_0907 | Heparan sulfate Click for more detail | NA | COC1C(C(C(OC1C(=O)[O-])OC2C(OC(C(C2[O-])NOS(=O)(=O)O)OC)COS(=O)(=O)O)OS(=O)(=O)O)O | NA | Damage-associated molecular patterns (DAMPs) | Natural | induce the maturation of DCs | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Mice (Murine) | neutrophils, macrophages, and dendritic cells | TIR domain- containing adaptor protein-inducing IFN- | Q9QUK6.fasta | Q9QUK6 | 835 | triggers the innate immune response and leads to the induction of adaptive immunity | NA | 21949773 | 2011 | Pubchem Assay |
| PRRID_0907 | Heparan sulfate Click for more detail | NA | COC1C(C(C(OC1C(=O)[O-])OC2C(OC(C(C2[O-])NOS(=O)(=O)O)OC)COS(=O)(=O)O)OS(=O)(=O)O)O | NA | Damage-associated molecular patterns (DAMPs) | Natural | induce the maturation of DCs | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Mice (Murine) | neutrophils, macrophages, and dendritic cells | TIR domain- containing adaptor protein-inducing IFN- | Q9QUK6.fasta | Q9QUK6 | 835 | triggers the innate immune response and leads to the induction of adaptive immunity | NA | 21949773 | 2011 | Pubchem Assay |
| PRRID_0909 | HMGB1 Click for more detail | Endogenous (others) | MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEDDEEDEEDEEEEEEEEDEDEEEDDDDE | 215 | Protein | Natural | HMGB1 plays a pivotal role in ischemic brain injury | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Mice (Murine) | neutrophils, macrophages, and dendritic cells | TIR domain- containing adaptor protein-inducing IFN- | Q9QUK6.fasta | Q9QUK6 | 835 | triggers the innate immune response and leads to the induction of adaptive immunity | NA | 21949773 | 2011 | Pubchem Assay |
| PRRID_0909 | HMGB1 Click for more detail | Endogenous (others) | MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEDDEEDEEDEEEEEEEEDEDEEEDDDDE | 215 | Protein | Natural | HMGB1 plays a pivotal role in ischemic brain injury | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Mice (Murine) | neutrophils, macrophages, and dendritic cells | TIR domain- containing adaptor protein-inducing IFN- | Q9QUK6.fasta | Q9QUK6 | 835 | triggers the innate immune response and leads to the induction of adaptive immunity | NA | 21949773 | 2011 | Pubchem Assay |
| PRRID_0921 | Lipopolysaccharide (LPS) Click for more detail | Gram-negative bacteria | CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC | NA | Lipopolysaccharide (LPS) | Natural | LPS was also shown to play a role in alloimmune lung injury | Toll-like receptor 4/MD-2 (TLR4/MD-2) | Toll-like receptor (TLR) | Mice | NA | intracellular TIR domains | Q9QUK6.fasta | Q9QUK6 | 835 | TLR 4 leads to an intracellular signaling pathway NF-κB and inflammatory cytokine production which is responsible for activating the innate immune system | NA | 21959264 | 2011 | Pubchem Assay |
| PRRID_0921 | Lipopolysaccharide (LPS) Click for more detail | Gram-negative bacteria | CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC | NA | Lipopolysaccharide (LPS) | Natural | LPS was also shown to play a role in alloimmune lung injury | Toll-like receptor 4/MD-2 (TLR4/MD-2) | Toll-like receptor (TLR) | Mice | NA | intracellular TIR domains | Q9QUK6.fasta | Q9QUK6 | 835 | TLR 4 leads to an intracellular signaling pathway NF-κB and inflammatory cytokine production which is responsible for activating the innate immune system | NA | 21959264 | 2011 | Pubchem Assay |
| PRRID_0924 | Lipopolysaccharide (LPS) Click for more detail | Gram-negative bacteria | CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC | NA | Lipopolysaccharide (LPS) | Natural | LPS was also shown to play a role in alloimmune lung injury | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Mice (Murine) | neutrophils, macrophages, and dendritic cells | TIR domain- containing adaptor protein-inducing IFN- | Q9QUK6.fasta | Q9QUK6 | 835 | triggers the innate immune response and leads to the induction of adaptive immunity | NA | 21949773 | 2011 | Pubchem Assay |
| PRRID_0924 | Lipopolysaccharide (LPS) Click for more detail | Gram-negative bacteria | CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC | NA | Lipopolysaccharide (LPS) | Natural | LPS was also shown to play a role in alloimmune lung injury | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Mice (Murine) | neutrophils, macrophages, and dendritic cells | TIR domain- containing adaptor protein-inducing IFN- | Q9QUK6.fasta | Q9QUK6 | 835 | triggers the innate immune response and leads to the induction of adaptive immunity | NA | 21949773 | 2011 | Pubchem Assay |
| PRRID_0942 | Pam2CSK4 Click for more detail | NA | CCCCCCCCCCCCCCCC(=O)OCC(CSCC(C(=O)NC(CO)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)O)N)OC(=O)CCCCCCCCCCCCCCC | NA | diacylated lipopeptide | Synthetic | Bacterial lipoproteins are strong immune modulators that activate early innate host responses after infection | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Mice | NA | intracellular TIR domains | Q9QUN7.fasta | Q9QUN7 | 784 | fundamental role in pathogen recognition and activation of innate immunity | NA | 21959264 | 2011 | Pubchem Assay |
| PRRID_0942 | Pam2CSK4 Click for more detail | NA | CCCCCCCCCCCCCCCC(=O)OCC(CSCC(C(=O)NC(CO)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)O)N)OC(=O)CCCCCCCCCCCCCCC | NA | diacylated lipopeptide | Synthetic | Bacterial lipoproteins are strong immune modulators that activate early innate host responses after infection | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Mice | NA | intracellular TIR domains | Q9QUN7.fasta | Q9QUN7 | 784 | fundamental role in pathogen recognition and activation of innate immunity | NA | 21959264 | 2011 | Pubchem Assay |
| PRRID_0945 | Pam3CSK4 Click for more detail | Bacteria | CCCCCCCCCCCCCCCC(=O)NC(CSCC(COC(=O)CCCCCCCCCCCCCCC)OC(=O)CCCCCCCCCCCCCCC)C(=O)NC(CO)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)O | NA | Lipoprotein | Synthetic | Mimics the acylated amino terminus of bacterial LPs and is a potent activator of the proinflammatory transcription factor NF-κB. | Toll-like receptor (TLR1/Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Mice | NA | intracellular TIR domains | NA | NA | NA | TLR2 is involved in the specific recognition of a wide range of ligands, either as a homodimer or as a heterodimer with TLR1 or TLR6 | NA | 21959264 | 2011 | NA |
| PRRID_0945 | Pam3CSK4 Click for more detail | Bacteria | CCCCCCCCCCCCCCCC(=O)NC(CSCC(COC(=O)CCCCCCCCCCCCCCC)OC(=O)CCCCCCCCCCCCCCC)C(=O)NC(CO)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)O | NA | Lipoprotein | Synthetic | Mimics the acylated amino terminus of bacterial LPs and is a potent activator of the proinflammatory transcription factor NF-κB. | Toll-like receptor (TLR1/Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Mice | NA | intracellular TIR domains | NA | NA | NA | TLR2 is involved in the specific recognition of a wide range of ligands, either as a homodimer or as a heterodimer with TLR1 or TLR6 | NA | 21959264 | 2011 | NA |
| PRRID_0983 | CBLB613 Click for more detail | Mycoplasma (Bacteria) | NA | NA | Lipopeptides | Natural | reduced radiation-induced cytopenia and increased bone marrow cellularity in irradiated mice | Toll-like receptor 2/6 (TLR2/6) | Toll-like receptor (TLR) | CD2F1 Mice | NA | Leucine-rich Repeat (LRR) Domain | NA | NA | NA | NA | NA | 22175300 | 2012 | NA |
| PRRID_0983 | CBLB613 Click for more detail | Mycoplasma (Bacteria) | NA | NA | Lipopeptides | Natural | reduced radiation-induced cytopenia and increased bone marrow cellularity in irradiated mice | Toll-like receptor 2/6 (TLR2/6) | Toll-like receptor (TLR) | CD2F1 Mice | NA | Leucine-rich Repeat (LRR) Domain | NA | NA | NA | NA | NA | 22175300 | 2012 | NA |
| PRRID_1021 | ATP Click for more detail | NA | C1=NC2=C(C(=N1)N)N=CN2C3C(C(C(O3)COP(=O)(O)OP(=O)(O)OP(=O)(O)O)O)O | NA | Damage-associated molecular patterns (DAMPs) | Natural | triggers immune responses | Nod-like receptor protein 3 (P2X7R) (NLRP3 (P2X7R) | NOD-like receptor (NLR) | Mice | graft-versus-host disease (GVHD) | NA | Q8BHB0.fasta | Q8BHB0 | 953 | Blockade of ATP-P2X7R signaling pathways decreased acute GVHD | NA | 23985302 | 2013 | Pubchem Assay |
| PRRID_1021 | ATP Click for more detail | NA | C1=NC2=C(C(=N1)N)N=CN2C3C(C(C(O3)COP(=O)(O)OP(=O)(O)OP(=O)(O)O)O)O | NA | Damage-associated molecular patterns (DAMPs) | Natural | triggers immune responses | Nod-like receptor protein 3 (P2X7R) (NLRP3 (P2X7R) | NOD-like receptor (NLR) | Mice | graft-versus-host disease (GVHD) | NA | Q8BHB0.fasta | Q8BHB0 | 953 | Blockade of ATP-P2X7R signaling pathways decreased acute GVHD | NA | 23985302 | 2013 | Pubchem Assay |
| PRRID_1025 | Bacterial RNA Click for more detail | Bacteria | NA | NA | Nucleic Acid | Natural | elicit innate immune response | Toll-like receptor 13 (TLR13) | Toll-like receptor (TLR) | Mice | NA | NA | Q6R5N8.fasta | Q6R5N8 | 991 | NA | NA | 23985302 | 2013 | Pubchem Assay |
| PRRID_1025 | Bacterial RNA Click for more detail | Bacteria | NA | NA | Nucleic Acid | Natural | elicit innate immune response | Toll-like receptor 13 (TLR13) | Toll-like receptor (TLR) | Mice | NA | NA | Q6R5N8.fasta | Q6R5N8 | 991 | NA | NA | 23985302 | 2013 | Pubchem Assay |
| PRRID_1026 | Bropirimine Click for more detail | NA | C1=CC=C(C=C1)C2=C(C(=O)N=C(N2)N)Br | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | experimental drug with anti-cancer and antiviral properties | Toll-like receptor 7 (TLR7) | Toll-like receptor (TLR) | Mice | monocyte/macrophages, plasmacytoid DCs and B-lymphocytes | Cell Compartment/Intracellular (Endosome) | P58681.fasta | P58681 | 1050 | important role in the immune response to viral infection | NA | 23985302 | 2013 | Pubchem Assay |
| PRRID_1026 | Bropirimine Click for more detail | NA | C1=CC=C(C=C1)C2=C(C(=O)N=C(N2)N)Br | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | experimental drug with anti-cancer and antiviral properties | Toll-like receptor 7 (TLR7) | Toll-like receptor (TLR) | Mice | monocyte/macrophages, plasmacytoid DCs and B-lymphocytes | Cell Compartment/Intracellular (Endosome) | P58681.fasta | P58681 | 1050 | important role in the immune response to viral infection | NA | 23985302 | 2013 | Pubchem Assay |
| PRRID_1027 | cytosine-phosphorothioate-guanine oligodeoxynucleotides (CpG ODNs) Click for more detail | Bacteria | NA | NA | Nucleic Acid | Synthetic | mimic bacterial and viral DNA and was also shown to be involved in GVHD | Toll-like receptor 9 (TLR9) | Toll-like receptor (TLR) | Mice | graft-versus-host disease (GVHD) | NA | Q9NR96.fasta | Q9NR96 | 1032 | induces pro-inflammatory cytokine response | NA | 23985302 | 2013 | Pubchem Assay |
| PRRID_1027 | cytosine-phosphorothioate-guanine oligodeoxynucleotides (CpG ODNs) Click for more detail | Bacteria | NA | NA | Nucleic Acid | Synthetic | mimic bacterial and viral DNA and was also shown to be involved in GVHD | Toll-like receptor 9 (TLR9) | Toll-like receptor (TLR) | Mice | graft-versus-host disease (GVHD) | NA | Q9NR96.fasta | Q9NR96 | 1032 | induces pro-inflammatory cytokine response | NA | 23985302 | 2013 | Pubchem Assay |
| PRRID_1029 | DNA (immune complexes) Click for more detail | Endogenous (others) | NA | NA | Nucleic Acid | Natural | triggers immune responses | Toll-like receptor 9 (TLR9) | Toll-like receptor (TLR) | Mice | monocyte/macrophages, plasmacytoid DCs and B-lymphocytes | Cell Compartment/Intracellular (Endosome) | Q9NR96.fasta | Q9NR96 | 1032 | induces pro-inflammatory cytokine response | NA | 23985302 | 2013 | Pubchem Assay |
| PRRID_1029 | DNA (immune complexes) Click for more detail | Endogenous (others) | NA | NA | Nucleic Acid | Natural | triggers immune responses | Toll-like receptor 9 (TLR9) | Toll-like receptor (TLR) | Mice | monocyte/macrophages, plasmacytoid DCs and B-lymphocytes | Cell Compartment/Intracellular (Endosome) | Q9NR96.fasta | Q9NR96 | 1032 | induces pro-inflammatory cytokine response | NA | 23985302 | 2013 | Pubchem Assay |