Detailed description page of PRRDB2.0
This page displays user query in tabular form. |
PRRID_0777 details |
Primary information | |
---|---|
PRRID | PRRID_0777 |
Ligand Name | PrgJ |
Source | S. typhimurium (Bacteria) |
Sequence of ligand | MSIATIVPENAVIGQAVNIRSMETDIVSLDDRLLQAFSGSAIATAVDKQTITNRIEDPNLVTDPKELAISQEMISDYNLYVSMVSTLTRKGVGAVETLLRS |
Length | 101 |
Type | Protein |
Occurence | Natural |
Role of Ligand | It activates caspase-1 through NLRC4 and secrete IL-1β |
Name of receptor | Nod-like receptor C4 (NLRC4) |
Type of receptor | NOD-like receptor (NLR) |
Source | Mice |
Localization | Bone marrow–derived macrophages |
Domain | NA |
Sequence of Receptor | Q3UP24.fasta |
Swiss prot ID | Q3UP24 |
Length Of Receptor | 1024 |
Function | It leads to the clearance of the pathogen from the system |
Assay used | ELISA |
PMID | 20133635 |
Year of Publication | 2010 |
Pubchem assay | Pubchem Assay |
Primary information | |
---|---|
PRRID | PRRID_0777 |
Ligand Name | PrgJ |
Source | S. typhimurium (Bacteria) |
Sequence of ligand | MSIATIVPENAVIGQAVNIRSMETDIVSLDDRLLQAFSGSAIATAVDKQTITNRIEDPNLVTDPKELAISQEMISDYNLYVSMVSTLTRKGVGAVETLLRS |
Length | 101 |
Type | Protein |
Occurence | Natural |
Role of Ligand | It activates caspase-1 through NLRC4 and secrete IL-1β |
Name of receptor | Nod-like receptor C4 (NLRC4) |
Type of receptor | NOD-like receptor (NLR) |
Source | Mice |
Localization | Bone marrow–derived macrophages |
Domain | NA |
Sequence of Receptor | Q3UP24.fasta |
Swiss prot ID | Q3UP24 |
Length Of Receptor | 1024 |
Function | It leads to the clearance of the pathogen from the system |
Assay used | ELISA |
PMID | 20133635 |
Year of Publication | 2010 |
Pubchem assay | Pubchem Assay |