| Primary information |
|---|
| PRRID | PRRID_0909 |
| Ligand Name | HMGB1 |
| Source | Endogenous (others) |
| Sequence of ligand | MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEDDEEDEEDEEEEEEEEDEDEEEDDDDE |
| Length | 215 |
| Type | Protein |
| Occurence | Natural |
| Role of Ligand | HMGB1 plays a pivotal role in ischemic brain injury |
| Name of receptor | Toll-like receptor 4 (TLR4) |
| Type of receptor | Toll-like receptor (TLR) |
| Source | Mice (Murine) |
| Localization | neutrophils, macrophages, and dendritic cells |
| Domain | TIR domain- containing adaptor protein-inducing IFN- |
| Sequence of Receptor | Q9QUK6.fasta |
| Swiss prot ID | Q9QUK6 |
| Length Of Receptor | 835 |
| Function | triggers the innate immune response and leads to the induction of adaptive immunity |
| Assay used | NA |
| PMID | 21949773 |
| Year of Publication | 2011 |
| Pubchem assay | Pubchem Assay |
| Primary information |
|---|
| PRRID | PRRID_0909 |
| Ligand Name | HMGB1 |
| Source | Endogenous (others) |
| Sequence of ligand | MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEDDEEDEEDEEEEEEEEDEDEEEDDDDE |
| Length | 215 |
| Type | Protein |
| Occurence | Natural |
| Role of Ligand | HMGB1 plays a pivotal role in ischemic brain injury |
| Name of receptor | Toll-like receptor 4 (TLR4) |
| Type of receptor | Toll-like receptor (TLR) |
| Source | Mice (Murine) |
| Localization | neutrophils, macrophages, and dendritic cells |
| Domain | TIR domain- containing adaptor protein-inducing IFN- |
| Sequence of Receptor | Q9QUK6.fasta |
| Swiss prot ID | Q9QUK6 |
| Length Of Receptor | 835 |
| Function | triggers the innate immune response and leads to the induction of adaptive immunity |
| Assay used | NA |
| PMID | 21949773 |
| Year of Publication | 2011 |
| Pubchem assay | Pubchem Assay |