| ID | PEPTIDE SEQUENCE | PEPTIDE NAME | LENGTH | CHIRALITY | LINEAR/CYCLIC | SOURCE | CATEGORY | N TERMINAL MODIFICATION | C TERMINAL MODIFICATION | CHEMICAL MODIFICATION | CARGO | PUBMED ID |
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 2687 | RRRRRRR | p53-R7 | 7 | L | Linear | Synthetic | Cationic | Conjugated to p53 | NA | NA | Protein (p53) | 22465335 |
| 2688 | RRRRRRRRRRR | p53-R11 | 11 | L | Linear | Synthetic | Cationic | Conjugated to p53 | NA | NA | Protein (p53) | 22465335 |
| 2698 | rrrrrrrr | dR8-p53C' | 8 | D | Linear | Synthetic | Cationic | NA | Amidation | NA | Protein (p53) | 22486588 |
| 2699 | fflipkgrrrrrrrr | dPasR8-p53C' | 15 | D | Linear | Synthetic | Cationic | NA | Amidation | NA | Protein (p53) | 22486588 |
| 2700 | ffffgrrrrrrrrgc | dF4R8-p53C' | 15 | D | Linear | Synthetic | Cationic | NA | Amidation | NA | Protein (p53) | 22486588 |
| 2772 | RQIKIWFQNRRMKWKK | Penetratin | 16 | L | Linear | Protein derived | Cationic and amphipathic | Free | Free | NA | Protein (Single-Chain Antibody) | 23160949 |
| 2817 | GRKKRRQRRRPPQRKC | Tat | 16 | L | Linear | Protein derived | Cationic | Free | Free | NA | Protein [synthetic salmon CT (sCT)] | 23802147 |
| 2820 | EARPALLTSRLRFIPK | GV1001 | 16 | L | Linear | Protein derived | NA | Free | Free | NA | Protein (eGFP) | 23827187 |
| 2821 | VSRRRRRRGGRRRR | low molecular weight protamine (LMWP) | 14 | L | Linear | Chimeric | Cationic | Sulfhydrylation | Free | Sulfhydrylation | Protein (Insulin-PEG-LMWP) | 23863452 |
| 2822 | GRKKRRQRRR | Tat (TG) | 10 | L | Linear | Protein derived | Cationic | NA | NA | NA | Protein (GFP, anti-oxidative metallothionein protein) | 23871961 |
| 2823 | GRKKRRQRRRMVSAL | TatsMTS (TMG) | 15 | L | Linear | Protein derived | Cationic | NA | NA | NA | Protein (GFP, anti-oxidative metallothionein protein) | 23871961 |
| 2828 | MIIYRDLISH | TCTPPTD | 10 | L | Linear | Protein derived | NA | Free | Free | NA | Protein (eGFP) | 23256924 |
| 2899 | RQIKIWFQNRRMKWKK | L-Penetratin | 16 | L | Linear | Protein derived | Cationic and amphipathic | Free | Free | NA | Protein (Insulin) | 25445695 |
| 2900 | rqikiwfqnrrmkwkk | D-Penetratin | 16 | D | Linear | Protein derived | Cationic and amphipathic | Free | Free | NA | Protein (Insulin) | 25445695 |
| 2907 | RRLSYSRRRF | SynB3 | 10 | L | Linear | Protein derived | Cationic | Free | Free | NA | Protein (Endomorphin-1) | 25245547 |
| 1206 | RKKRRRESRKKRRRES | DPV3 | 16 | L | Linear | Protein derived | Unknown | Cys addition | Free | NA | Protein (PO and IgG) | 15859953 |
| 1207 | GRPRESGKKRKRKRLKP | DPV6 | 17 | L | Linear | Protein derived | Unknown | Cys addition | Free | NA | Protein (PO and IgG) | 15859953 |
| 1208 | GKRKKKGKLGKKRDP | DPV7 | 15 | L | Linear | Protein derived | Unknown | Cys addition | Free | NA | Protein (PO and IgG) | 15859953 |
| 1209 | GKRKKKGKLGKKRPRSR | DPV7b | 17 | L | Linear | Protein derived | Unknown | Cys addition | Free | NA | Protein (PO and IgG) | 15859953 |
| 1210 | RKKRRRESRRARRSPRHL | DPV3/10 | 18 | L | Linear | Protein derived | Unknown | Cys addition | Free | NA | Protein (PO and IgG) | 15859953 |
| 1211 | SRRARRSPRESGKKRKRKR | DPV10/6 | 19 | L | Linear | Protein derived | Unknown | Cys addition | Free | NA | Protein (PO and IgG) | 15859953 |
| 1212 | VKRGLKLRHVRPRVTRMDV | DPV1047 | 19 | L | Linear | Protein derived | Unknown | Cys addition | Free | NA | Protein (PO and IgG) | 15859953 |
| 1213 | SRRARRSPRHLGSG | DPV10 | 14 | L | Linear | Protein derived | Unknown | Cys addition | Free | NA | Protein (PO and IgG) | 15859953 |
| 1214 | LRRERQSRLRRERQSR | DPV15 | 16 | L | Linear | Protein derived | Unknown | Cys addition | Free | NA | Protein (PO and IgG) | 15859953 |
| 1215 | GAYDLRRRERQSRLRRRERQSR | DPV15b | 22 | L | Linear | Protein derived | Unknown | Cys addition | Free | NA | Protein (PO and IgG) | 15859953 |
| 1216 | GRKKRRQRRRPPQ | Tat (48-60) | 13 | L | Linear | Protein derived | Cationic | Cys addition | Free | NA | Protein (PO and IgG) | 15859953 |
| 1426 | akvkdepqrrsarlsakpappkpepkpkkapakk | D form of F3 | 34 | D | Linear | Protein derived | Unknown | Conjugation with fluorescein with 6-aminohexanoic acid (Ahx) spacer | Free | NA | Protein (eGFP) | 12032302 |
| 1427 | PLSSIFSRIGDP | PreS2 (41-52) | 12 | L | Linear | Protein derived | Amphipathic | Conjugation with EGFP | Free | NA | Protein (eGFP) | 10822301 |
| 1496 | RKKRRQRRR | Tat (49-57) | 9 | L | Linear | Protein derived | Cationic | Free | Conjugation with GFP | NA | Protein (GFP) | 11211880 |
| 1497 | RQIKIWFQNRRMKWKK | Penetratin {pAntp-(43-58)} | 16 | L | Linear | Protein derived | Amphipathic | Free | Conjugation with GFP | NA | Protein (GFP) | 11211880 |
| 1498 | SKRTRQTYTRYQTLELEKEFHFNRYITRRRRIDIANALSLSERQIKIWFQNRRMKSKKDR | Fushi- tarazu (254-313) | 60 | L | Linear | Protein derived | Amphipathic | Free | Conjugation with GFP | NA | Protein (GFP) | 11211880 |
| 1499 | EKRPRTAFSSEQLARLKREFNENRYLTTERRRQQLSSELGLNEAQIKIWFQNKRAKIKKST | Engrailed (454-513) | 61 | L | Linear | Protein derived | Amphipathic | Free | Conjugation with GFP | NA | Protein (GFP) | 11211880 |
| 1535 | RLSGMNEVLSFRWL | SG3 | 14 | L | Linear | Synthetic | Unknown | Conjugation with EGFP | Free | NA | Protein (GFP) | 21291271 |
| 1636 | RIFIHFRIGC | LR15DL | 10 | L | Linear | Synthetic | Unknown | Free | Conjugation with nanoparticle | NA | Nanoparticle, Protein (eGFP) | 0 |
| 1645 | KRIIQRILSRNS | Peptide 1 | 12 | L | Linear | Synthetic | Unknown | NA | NA | NA | Protein (?-galactosidase), Phages | 0 |
| 1646 | KRIHPRLTRSIR | Peptide 2 | 12 | L | Linear | Synthetic | Unknown | NA | NA | NA | Protein (?-galactosidase), Phages | 0 |
| 1647 | PPRLRKRRQLNM | Peptide 3 | 12 | L | Linear | Synthetic | Unknown | NA | NA | NA | Protein (?-galactosidase), Phages | 0 |
| 1648 | PIRRRKKLRRLK | Peptide 4 | 12 | L | Linear | Synthetic | Unknown | NA | NA | NA | Protein (?-galactosidase), Phages | 0 |
| 1649 | RRQRRTSKLMKR | Peptide 5 | 12 | L | Linear | Synthetic | Unknown | NA | NA | NA | Protein (?-galactosidase, eGFP), Phages | 0 |
| 1650 | MHKRPTTPSRKM | Peptide 6 | 12 | L | Linear | Synthetic | Unknown | NA | NA | NA | Protein (?-galactosidase), Phages | 0 |
| 1721 | YARAARRAARR | CTP50 | 11 | L | Linear | Synthetic | Unknown | Free | Fusion with beta-Gal | NA | Protein (?-galactosidase) | 0 |
| 1722 | PARAARRAARR | CTP501 | 11 | L | Linear | Synthetic | Unknown | Free | Fusion with beta-Gal | NA | Protein (?-galactosidase) | 0 |
| 1723 | YPRAARRAARR | CTP502 | 11 | L | Linear | Synthetic | Unknown | Free | Fusion with beta-Gal | NA | Protein (?-galactosidase) | 0 |
| 1724 | YRRAARRAARA | CTP503 | 11 | L | Linear | Synthetic | Unknown | Free | Fusion with beta-Gal | NA | Protein (?-galactosidase) | 0 |
| 1725 | YGRAARRAARR | CTP504 | 11 | L | Linear | Synthetic | Unknown | Free | Fusion with beta-Gal | NA | Protein (?-galactosidase) | 0 |
| 1726 | YAREARRAARR | CTP505 | 11 | L | Linear | Synthetic | Unknown | Free | Fusion with beta-Gal | NA | Protein (?-galactosidase) | 0 |
| 1727 | YEREARRAARR | CTP506 | 11 | L | Linear | Synthetic | Unknown | Free | Fusion with beta-Gal | NA | Protein (?-galactosidase) | 0 |
| 1728 | YKRAARRAARR | CTP507 | 11 | L | Linear | Synthetic | Unknown | Free | Fusion with beta-Gal | NA | Protein (?-galactosidase) | 0 |
| 1729 | YARKARRAARR | CTP508 | 11 | L | Linear | Synthetic | Unknown | Free | Fusion with beta-Gal | NA | Protein (?-galactosidase) | 0 |
| 1730 | YKRKARRAARR | CTP509 | 11 | L | Linear | Synthetic | Unknown | Free | Fusion with beta-Gal | NA | Protein (?-galactosidase) | 0 |