Browse result page of AntiTbPdb
The total number entries retrieved from this search are 112
| ID | Name | Sequence | N-Terminal Modification | C-Terminal Modification | Chemical Modification | Linear/Cyclic | Length | Chirality | Nature | Source | Origin | Species | Strain | Inhibition Concentration | In vitro/ In vivo | Cell Line | Intracellular Inhibition | Cytotoxicity | Animal Model | Effective Dose in model organism | Immune Responce | Mechanism of Action | Target | Combination Therapy | Other Activities | Year of Publication | Pubmed ID/ Patent No. |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| antitb_1447 | A2-Rv2958 | ALADLPVTV | Free | Free | None | Linear | 9 | L | NA | Protein derived | MTB derived protein Rv2958 | Mycobacterium tuberculosis | Mycobacterium tuberculosis Rv2958 | NA | NA | NA | NA | NA | NA | NA | IL7Rα expression reduced and CD107a expression also decreased among CD8+ T cell after post TB treatment | Drug treatement of TB with antiTB drug found to decrease the frequency of MTB Antigen CD8+ T-cell, so evaluation of these antigenic peptide after TB treatment serve as a valuable marker for the evaluation of TB therapy. | CD8+ T-cell | NA | NA | 2104 | 25809751 |
| antitb_1448 | A2-Rv2957 | SIIIPTLNV | Free | Free | None | Linear | 9 | L | NA | Protein derived | MTB derived protein Rv2958 | Mycobacterium tuberculosis | Mycobacterium tuberculosis Rv2958 | NA | NA | NA | NA | NA | NA | NA | IL7Rα expression reduced and CD107a expression also decreased among CD8+ T cell after post TB treatment | Drug treatement of TB with antiTB drug found to decrease the frequency of MTB Antigen CD8+ T-cell, so evaluation of these antigenic peptide after TB treatment serve as a valuable marker for the evaluation of TB therapy. | CD8+ T-cell | NA | NA | 2104 | 25809751 |
| antitb_1449 | A2-Rv0447 | VLAGSVDEL | Free | Free | None | Linear | 9 | L | NA | Protein derived | MTB derived protein Rv0447 | Mycobacterium tuberculosis | Mycobacterium tuberculosis Rv0447 | NA | NA | NA | NA | NA | NA | NA | IL7Rα expression reduced and CD107a expression also decreased among CD8+ T cell after post TB treatment | Drug treatement of TB with antiTB drug found to decrease the frequency of MTB Antigen CD8+ T-cell, so evaluation of these antigenic peptide after TB treatment serve as a valuable marker for the evaluation of TB therapy. | CD8+ T-cell | NA | NA | 2104 | 25809751 |
| antitb_1450 | A24-TB10.4 | IMYNYPAML | Free | Free | None | Linear | 9 | L | NA | Protein derived | MTB derived protein Rv0447 | Mycobacterium tuberculosis | Mycobacterium tuberculosis Rv0447 | NA | NA | NA | NA | NA | NA | NA | IL7Rα expression reduced and CD107a expression also decreased among CD8+ T cell after post TB treatment | Drug treatement of TB with antiTB drug found to decrease the frequency of MTB Antigen CD8+ T-cell, so evaluation of these antigenic peptide after TB treatment serve as a valuable marker for the evaluation of TB therapy. | CD8+ T-cell | NA | NA | 2104 | 25809751 |
| antitb_1451 | A24-Ag85B | WYYQSGLSI | Free | Free | None | Linear | 9 | L | NA | Protein derived | MTB derived protein Ag85B | Mycobacterium tuberculosis | Mycobacterium tuberculosis Rv | NA | NA | NA | NA | NA | NA | NA | IL7Rα expression reduced and CD107a expression also decreased among CD8+ T cell after post TB treatment | Drug treatement of TB with antiTB drug found to decrease the frequency of MTB Antigen CD8+ T-cell, so evaluation of these antigenic peptide after TB treatment serve as a valuable marker for the evaluation of TB therapy. | CD8+ T-cell | NA | NA | 2104 | 25809751 |
| antitb_1452 | A24-Ag85B | FLTSELPQW | Free | Free | None | Linear | 9 | L | NA | Protein derived | MTB derived protein Ag85B | Mycobacterium tuberculosis | Mycobacterium tuberculosis Rv | NA | NA | NA | NA | NA | NA | NA | IL7Rα expression reduced and CD107a expression also decreased among CD8+ T cell after post TB treatment | Drug treatement of TB with antiTB drug found to decrease the frequency of MTB Antigen CD8+ T-cell, so evaluation of these antigenic peptide after TB treatment serve as a valuable marker for the evaluation of TB therapy. | CD8+ T-cell | NA | NA | 2104 | 25809751 |
| antitb_1453 | A24-Ag85B | IYAGSLSAL | Free | Free | None | Linear | 9 | L | NA | Protein derived | MTB derived protein Ag85B | Mycobacterium tuberculosis | Mycobacterium tuberculosis Rv | NA | NA | NA | NA | NA | NA | NA | IL7Rα expression reduced and CD107a expression also decreased among CD8+ T cell after post TB treatment | Drug treatement of TB with antiTB drug found to decrease the frequency of MTB Antigen CD8+ T-cell, so evaluation of these antigenic peptide after TB treatment serve as a valuable marker for the evaluation of TB therapy. | CD8+ T-cell | NA | NA | 2104 | 25809751 |
| antitb_1454 | A24-ESAT6 | AYQGVQQKW | Free | Free | None | Linear | 9 | L | NA | Protein derived | MTB derived protein ESAT6 | Mycobacterium tuberculosis | Mycobacterium tuberculosis Rv | NA | NA | NA | NA | NA | NA | NA | IL7Rα expression reduced and CD107a expression also decreased among CD8+ T cell after post TB treatment | Drug treatement of TB with antiTB drug found to decrease the frequency of MTB Antigen CD8+ T-cell, so evaluation of these antigenic peptide after TB treatment serve as a valuable marker for the evaluation of TB therapy. | CD8+ T-cell | NA | NA | 2104 | 25809751 |
| antitb_1455 | A24-ESAT6 | ELNNALQNL | Free | Free | None | Linear | 9 | L | NA | Protein derived | MTB derived protein ESAT6 | Mycobacterium tuberculosis | Mycobacterium tuberculosis Rv | NA | NA | NA | NA | NA | NA | NA | IL7Rα expression reduced and CD107a expression also decreased among CD8+ T cell after post TB treatment | Drug treatement of TB with antiTB drug found to decrease the frequency of MTB Antigen CD8+ T-cell, so evaluation of these antigenic peptide after TB treatment serve as a valuable marker for the evaluation of TB therapy. | CD8+ T-cell | NA | NA | 2104 | 25809751 |
| antitb_1456 | A24-Rv2958 | KYIAADRKI | Free | Free | None | Linear | 9 | L | NA | Protein derived | MTB derived protein Rv2958 | Mycobacterium tuberculosis | Mycobacterium tuberculosis Rv2958 | NA | NA | NA | NA | NA | NA | NA | IL7Rα expression reduced and CD107a expression also decreased among CD8+ T cell after post TB treatment | Drug treatement of TB with antiTB drug found to decrease the frequency of MTB Antigen CD8+ T-cell, so evaluation of these antigenic peptide after TB treatment serve as a valuable marker for the evaluation of TB therapy. | CD8+ T-cell | NA | NA | 2104 | 25809751 |
| antitb_1457 | A24-Rv2957 | PYNLRYRVL | Free | Free | None | Linear | 9 | L | NA | Protein derived | MTB derived protein Rv2958 | Mycobacterium tuberculosis | Mycobacterium tuberculosis Rv2958 | NA | NA | NA | NA | NA | NA | NA | IL7Rα expression reduced and CD107a expression also decreased among CD8+ T cell after post TB treatment | Drug treatement of TB with antiTB drug found to decrease the frequency of MTB Antigen CD8+ T-cell, so evaluation of these antigenic peptide after TB treatment serve as a valuable marker for the evaluation of TB therapy. | CD8+ T-cell | NA | NA | 2104 | 25809751 |
| antitb_1458 | A24-Rv0447 | KYIFPGGLL | Free | Free | None | Linear | 9 | L | NA | Protein derived | MTB derived protein Rv0447 | Mycobacterium tuberculosis | Mycobacterium tuberculosis Rv | NA | NA | NA | NA | NA | NA | NA | IL7Rα expression reduced and CD107a expression also decreased among CD8+ T cell after post TB treatment | Drug treatement of TB with antiTB drug found to decrease the frequency of MTB Antigen CD8+ T-cell, so evaluation of these antigenic peptide after TB treatment serve as a valuable marker for the evaluation of TB therapy. | CD8+ T-cell | NA | NA | 2104 | 25809751 |
| antitb_1459 | A3001-TB10.4 | QIMYNYPAM | Free | Free | None | Linear | 9 | L | NA | Protein derived | MTB derived protein TB10.4 | Mycobacterium tuberculosis | Mycobacterium tuberculosis Rv | NA | NA | NA | NA | NA | NA | NA | IL7Rα expression reduced and CD107a expression also decreased among CD8+ T cell after post TB treatment | Drug treatement of TB with antiTB drug found to decrease the frequency of MTB Antigen CD8+ T-cell, so evaluation of these antigenic peptide after TB treatment serve as a valuable marker for the evaluation of TB therapy. | CD8+ T-cell | NA | NA | 2104 | 25809751 |
| antitb_1460 | A3001-TB10.4 | LVRAYHAMS | Free | Free | None | Linear | 9 | L | NA | Protein derived | MTB derived protein TB10.4 | Mycobacterium tuberculosis | Mycobacterium tuberculosis Rv | NA | NA | NA | NA | NA | NA | NA | IL7Rα expression reduced and CD107a expression also decreased among CD8+ T cell after post TB treatment | Drug treatement of TB with antiTB drug found to decrease the frequency of MTB Antigen CD8+ T-cell, so evaluation of these antigenic peptide after TB treatment serve as a valuable marker for the evaluation of TB therapy. | CD8+ T-cell | NA | NA | 2104 | 25809751 |
| antitb_1461 | A3001-Rv2957 | IVLVRRWPK | Free | Free | None | Linear | 9 | L | NA | Protein derived | MTB derived protein Rv2957 | Mycobacterium tuberculosis | Mycobacterium tuberculosis Rv2957 | NA | NA | NA | NA | NA | NA | NA | IL7Rα expression reduced and CD107a expression also decreased among CD8+ T cell after post TB treatment | Drug treatement of TB with antiTB drug found to decrease the frequency of MTB Antigen CD8+ T-cell, so evaluation of these antigenic peptide after TB treatment serve as a valuable marker for the evaluation of TB therapy. | CD8+ T-cell | NA | NA | 2104 | 25809751 |
| antitb_1462 | A3002-TB10.4 | QIMYNYPAM | Free | Free | None | Linear | 9 | L | NA | Protein derived | MTB derived protein TB10.4 | Mycobacterium tuberculosis | Mycobacterium tuberculosis Rv | NA | NA | NA | NA | NA | NA | NA | IL7Rα expression reduced and CD107a expression also decreased among CD8+ T cell after post TB treatment | Drug treatement of TB with antiTB drug found to decrease the frequency of MTB Antigen CD8+ T-cell, so evaluation of these antigenic peptide after TB treatment serve as a valuable marker for the evaluation of TB therapy. | CD8+ T-cell | NA | NA | 2104 | 25809751 |
| antitb_1463 | A3002-TB10.4 | IMYNYPAML | Free | Free | None | Linear | 9 | L | NA | Protein derived | MTB derived protein TB10.4 | Mycobacterium tuberculosis | Mycobacterium tuberculosis Rv | NA | NA | NA | NA | NA | NA | NA | IL7Rα expression reduced and CD107a expression also decreased among CD8+ T cell after post TB treatment | Drug treatement of TB with antiTB drug found to decrease the frequency of MTB Antigen CD8+ T-cell, so evaluation of these antigenic peptide after TB treatment serve as a valuable marker for the evaluation of TB therapy. | CD8+ T-cell | NA | NA | 2104 | 25809751 |
| antitb_1464 | A3002-TB10.4 | AMEDLVRAY | Free | Free | None | Linear | 9 | L | NA | Protein derived | MTB derived protein TB10.4 | Mycobacterium tuberculosis | Mycobacterium tuberculosis Rv | NA | NA | NA | NA | NA | NA | NA | IL7Rα expression reduced and CD107a expression also decreased among CD8+ T cell after post TB treatment | Drug treatement of TB with antiTB drug found to decrease the frequency of MTB Antigen CD8+ T-cell, so evaluation of these antigenic peptide after TB treatment serve as a valuable marker for the evaluation of TB therapy. | CD8+ T-cell | NA | NA | 2104 | 25809751 |
| antitb_1465 | A3002-ESAT6 | AMASTEGNV | Free | Free | None | Linear | 9 | L | NA | Protein derived | MTB derived protein ESAT6 | Mycobacterium tuberculosis | Mycobacterium tuberculosis Rv | NA | NA | NA | NA | NA | NA | NA | IL7Rα expression reduced and CD107a expression also decreased among CD8+ T cell after post TB treatment | Drug treatement of TB with antiTB drug found to decrease the frequency of MTB Antigen CD8+ T-cell, so evaluation of these antigenic peptide after TB treatment serve as a valuable marker for the evaluation of TB therapy. | CD8+ T-cell | NA | NA | 2104 | 25809751 |
| antitb_1466 | A3002-Rv2958 | SARLAGIPY | Free | Free | None | Linear | 9 | L | NA | Protein derived | MTB derived protein Rv2958 | Mycobacterium tuberculosis | Mycobacterium tuberculosis Rv2958 | NA | NA | NA | NA | NA | NA | NA | IL7Rα expression reduced and CD107a expression also decreased among CD8+ T cell after post TB treatment | Drug treatement of TB with antiTB drug found to decrease the frequency of MTB Antigen CD8+ T-cell, so evaluation of these antigenic peptide after TB treatment serve as a valuable marker for the evaluation of TB therapy. | CD8+ T-cell | NA | NA | 2104 | 25809751 |
| antitb_1467 | A3002-Rv0447 | RMWELYLAY | Free | Free | None | Linear | 9 | L | NA | Protein derived | MTB derived protein Rv0447 | Mycobacterium tuberculosis | Mycobacterium tuberculosis Rv2958 | NA | NA | NA | NA | NA | NA | NA | IL7Rα expression reduced and CD107a expression also decreased among CD8+ T cell after post TB treatment | Drug treatement of TB with antiTB drug found to decrease the frequency of MTB Antigen CD8+ T-cell, so evaluation of these antigenic peptide after TB treatment serve as a valuable marker for the evaluation of TB therapy. | CD8+ T-cell | NA | NA | 2104 | 25809751 |
| antitb_1468 | A68-TB10.4 | HAMSSTHEA | Free | Free | None | Linear | 9 | L | NA | Protein derived | MTB derived protein Rv0447 | Mycobacterium tuberculosis | Mycobacterium tuberculosis Rv0447 | NA | NA | NA | NA | NA | NA | NA | IL7Rα expression reduced and CD107a expression also decreased among CD8+ T cell after post TB treatment | Drug treatement of TB with antiTB drug found to decrease the frequency of MTB Antigen CD8+ T-cell, so evaluation of these antigenic peptide after TB treatment serve as a valuable marker for the evaluation of TB therapy. | CD8+ T-cell | NA | NA | 2104 | 25809751 |
| antitb_1469 | A68-TB10.4 | ANTMAMMAR | Free | Free | None | Linear | 9 | L | NA | Protein derived | MTB derived protein TB10.4 | Mycobacterium tuberculosis | Mycobacterium tuberculosis Rv | NA | NA | NA | NA | NA | NA | NA | IL7Rα expression reduced and CD107a expression also decreased among CD8+ T cell after post TB treatment | Drug treatement of TB with antiTB drug found to decrease the frequency of MTB Antigen CD8+ T-cell, so evaluation of these antigenic peptide after TB treatment serve as a valuable marker for the evaluation of TB therapy. | CD8+ T-cell | NA | NA | 2104 | 25809751 |
| antitb_1470 | A68-Ag85B | LPQWLSANR | Free | Free | None | Linear | 9 | L | NA | Protein derived | MTB derived protein Ag85B | Mycobacterium tuberculosis | Mycobacterium tuberculosis Rv | NA | NA | NA | NA | NA | NA | NA | IL7Rα expression reduced and CD107a expression also decreased among CD8+ T cell after post TB treatment | Drug treatement of TB with antiTB drug found to decrease the frequency of MTB Antigen CD8+ T-cell, so evaluation of these antigenic peptide after TB treatment serve as a valuable marker for the evaluation of TB therapy. | CD8+ T-cell | NA | NA | 2104 | 25809751 |
| antitb_1471 | A68-Ag85B | WGAQLNAMK | Free | Free | None | Linear | 9 | L | NA | Protein derived | MTB derived protein Ag85B | Mycobacterium tuberculosis | Mycobacterium tuberculosis Rv | NA | NA | NA | NA | NA | NA | NA | IL7Rα expression reduced and CD107a expression also decreased among CD8+ T cell after post TB treatment | Drug treatement of TB with antiTB drug found to decrease the frequency of MTB Antigen CD8+ T-cell, so evaluation of these antigenic peptide after TB treatment serve as a valuable marker for the evaluation of TB therapy. | CD8+ T-cell | NA | NA | 2104 | 25809751 |
| antitb_1472 | A68-Rv2958 | AAPEPVARR | Free | Free | None | Linear | 9 | L | NA | Protein derived | MTB derived protein Rv2958 | Mycobacterium tuberculosis | Mycobacterium tuberculosis Rv2958 | NA | NA | NA | NA | NA | NA | NA | IL7Rα expression reduced and CD107a expression also decreased among CD8+ T cell after post TB treatment | Drug treatement of TB with antiTB drug found to decrease the frequency of MTB Antigen CD8+ T-cell, so evaluation of these antigenic peptide after TB treatment serve as a valuable marker for the evaluation of TB therapy. | CD8+ T-cell | NA | NA | 2104 | 25809751 |
| antitb_1473 | A68-Rv2957 | LVYGDVIMR | Free | Free | None | Linear | 9 | L | NA | Protein derived | MTB derived protein Rv2957 | Mycobacterium tuberculosis | Mycobacterium tuberculosis Rv2957 | NA | NA | NA | NA | NA | NA | NA | IL7Rα expression reduced and CD107a expression also decreased among CD8+ T cell after post TB treatment | Drug treatement of TB with antiTB drug found to decrease the frequency of MTB Antigen CD8+ T-cell, so evaluation of these antigenic peptide after TB treatment serve as a valuable marker for the evaluation of TB therapy. | CD8+ T-cell | NA | NA | 2104 | 25809751 |
| antitb_1474 | A68-Rv0447 | AASAAIANR | Free | Free | None | Linear | 9 | L | NA | Protein derived | MTB derived protein Rv0447 | Mycobacterium tuberculosis | Mycobacterium tuberculosis Rv0447 | NA | NA | NA | NA | NA | NA | NA | IL7Rα expression reduced and CD107a expression also decreased among CD8+ T cell after post TB treatment | Drug treatement of TB with antiTB drug found to decrease the frequency of MTB Antigen CD8+ T-cell, so evaluation of these antigenic peptide after TB treatment serve as a valuable marker for the evaluation of TB therapy. | CD8+ T-cell | NA | NA | 2104 | 25809751 |
| antitb_1475 | B58-Ag85B | QTYKWETFL | Free | Free | None | Linear | 9 | L | NA | Protein derived | MTB derived protein Ag85B | Mycobacterium tuberculosis | Mycobacterium tuberculosis Rv | NA | NA | NA | NA | NA | NA | NA | IL7Rα expression reduced and CD107a expression also decreased among CD8+ T cell after post TB treatment | Drug treatement of TB with antiTB drug found to decrease the frequency of MTB Antigen CD8+ T-cell, so evaluation of these antigenic peptide after TB treatment serve as a valuable marker for the evaluation of TB therapy. | CD8+ T-cell | NA | NA | 2104 | 25809751 |
| antitb_1476 | Cw07-Ag85B | ANNTRLWVY | Free | Free | None | Linear | 9 | L | NA | Protein derived | MTB derived protein Ag85B | Mycobacterium tuberculosis | Mycobacterium tuberculosis Rv | NA | NA | NA | NA | NA | NA | NA | IL7Rα expression reduced and CD107a expression also decreased among CD8+ T cell after post TB treatment | Drug treatement of TB with antiTB drug found to decrease the frequency of MTB Antigen CD8+ T-cell, so evaluation of these antigenic peptide after TB treatment serve as a valuable marker for the evaluation of TB therapy. | CD8+ T-cell | NA | NA | 2104 | 25809751 |
| antitb_1528 | LL-37 | [LL-37, 37 aa] | Free | Free | None | Linear | 37 | L | Cationic | Protein derived | Derived from Human cationic antimicrobial protein 18 (hCAP18) | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 2.1 μg/ml | in vitro | Human macrophage THP1 | NA | No cytotoxicity | C57BL/6 Mice | NA | Induce expression of IL-8 and MCP-1 | In vitro binding of bacterilamembrane and induce pore formation while in vivo activate TLR and monocyte to kill bacteria | Bacterial cell membrane | NA | NA | 2015 | 25613372 |
| antitb_1529 | LLKKK-18 | KEFKRIVKRIKKFLRKLV | Free | Free | None | Linear | 18 | L | Cationic | Protein derived | Derived from Human cationic antimicrobial protein 18 (hCAP18) | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 25 μg/ml | in vitro | Human macrophage THP1 | NA | No cytotoxicity | NA | NA | Induce expression of IL-8 and MCP-1 | In vitro binding of bacterilamembrane and induce pore formation while in vivo activate TLR and monocyte to kill bacteria | Bacterial cell membrane | NA | NA | 2015 | 25613372 |
| antitb_1530 | D5 | KWKSFLKTFKSLKKTKLHTLLKLISS | Acetylation | Amidation | None | Linear | 27 | L | Cationic | Protein derived | Derived from Human cationic antimicrobial protein 18 (hCAP18) | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 35.2 μg/ml | in vitro | Human macrophage THP1 | NA | No cytotoxicity | NA | NA | Induce expression of IL-8and MCP-1 | In vitro binding of bacterilamembrane and induce pore formation while in vivo activate TLR and monocyte to kill bacteria | Bacterial cell membrane | NA | NA | 2015 | 25613372 |
| antitb_1531 | D5 | KWKSFLKTFKSLKKTKLHTLLKLISS | Acetylation | Amidation | None | Linear | 27 | L | Cationic | Protein derived | Derived from Human cationic antimicrobial protein 18 (hCAP18) | Mycobacterium tuberculosis | Mycobacterium tuberculosis MDR-TB | MIC = 49 μg/ml | in vitro | Human macrophage THP1 | NA | No cytotoxicity | NA | NA | Induce expression of IL-8and MCP-1 | In vitro binding of bacterilamembrane and induce pore formation while in vivo activate TLR and monocyte to kill bacteria | Bacterial cell membrane | NA | NA | 2015 | 25613372 |
| antitb_1532 | G13 | QRSVSNAATRVCRTGRSRW | Free | Free | None | Linear | 19 | L | Cationic | Protein derived | Derived from human granulysin protein | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | NA | in vitro | NA | NA | No cytotoxicity | NA | NA | NA | NA | NA | NA | NA | 2015 | 25613372 |
| antitb_1533 | GranF2 | VCRTGRSRWRDVNRNFMRRYQSR | Free | Free | None | Linear | 23 | L | Cationic | Protein derived | Derived from human granulysin protein | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | NA | in vitro | NA | NA | No cytotoxicity | NA | NA | NA | NA | NA | NA | NA | 2015 | 25613372 |
| antitb_1534 | Proregion | SVFPQQTTGQLAELQPQDRAGARASWMPMFQRRRRR | Free | Free | None | Linear | 36 | L | Cationic | Protein derived | Derived from Hepcidin protein | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | NA | in vitro | NA | NA | NA | NA | NA | induce expression of IFN-γ | Cause structural damage to mycobacteria | NA | NA | NA | 2015 | 25613372 |
| antitb_1538 | HCL2 | ESTYQGHHTPPVQKGLRYGIILFITSEVFFFAGFF | Free | Free | None | Linear | 35 | L | Cationic | Protein derived | Derived from Cytochrome C oxidase subunit 3 | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | NA | in vitro | Human macrophage THP1 | NA | No cytotoxicity | NA | NA | NA | Disrupt interaction between ESAT-6 and CFP10 | bacterial ESAT-6 | NA | NA | 2015 | 25613372 |
| antitb_1540 | Ub2 | STLHLVLRLRGG | Free | Free | None | Linear | 12 | L | Cationic | Protein derived | Derived from human ubiquitin protein | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 5 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Disrupt the mycobacterial membrane | NA | NA | Bactericidal against pseudomonas and staphylococcus at pH 5.5 | 2015 | 25613372 |
| antitb_1541 | RNase3 | RPPQFTRAQWFAIQHISLMPPRCTIAMRAINNYRWRCKNQNTFLR | Free | Free | None | Linear | 45 | L | Cationic | Protein derived | Derived from eisinophilic cationic protein (ECP) | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 20 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Disrupt the mycobacterial membrane | NA | NA | Bactericidal against pseudomonas and staphylococcus at pH 5.5 | 2015 | 25613372 |
| antitb_1542 | RNAse7 | RPPQFTRAQWFAIQHISLMPPRCTIAMRAINNYRWRCKNQNTFLR | Free | Free | None | Linear | 45 | L | Cationic | Protein derived | Derived from eisinophilic cationic protein (ECP) | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 10 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Disrupt the mycobacterial membrane | NA | NA | Bactericidal against pseudomonas and staphylococcus at pH 5.5 | 2015 | 25613372 |
| antitb_1543 | RNAse7 | RPPQFTRAQWFAIQHISLMPPRCTIAMRAINNYRWRCKNQNTFLR | Free | Free | None | Linear | 45 | L | Cationic | Protein derived | Derived from eisinophilic cationic protein (ECP) | Mycobacterium vaccae | Mycobacterium vaccae | MIC = 10 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Disrupt the mycobacterial membrane | NA | NA | Bactericidal against pseudomonas and staphylococcus at pH 5.5 | 2015 | 25613372 |
| antitb_1544 | Hepcidin | DTHFPICIFCCGCCHRSKCGMCCKT | Free | Free | None | Linear | 25 | L | Cationic | Protein derived | Derived from Hepcidin protein | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | NA | in vitro | NA | NA | NA | NA | NA | induce expression of IFN-γ | Cause structural damage to mycobacteria | NA | NA | NA | 2015 | 25613372 |
| antitb_1723 | SEQ ID NO 3 | NVTSIHSLL | Free | Free | None | Linear | 9 | L | NA | Protein Derived | From the proetins containing mycobacterial CD8 T cell epitopes | Mycobacterium tuberculosis | Mycobacterium tuberculosis | NA | In vitro | PBMcs | NA | NA | β2-microglobulin gene knowckout mice, TAP-1 null mutant mice and HSP-65 immunized mice | NA | IFN-γ release increases | By CD8 T cell response | NA | None | None | 2002 | US 2002/013197 |
| antitb_1724 | SEQ ID NO 4 | ELNNALQNLART | Free | Free | None | Linear | 12 | L | NA | Protein Derived | From the proetins containing mycobacterial CD8 T cell epitopes | Mycobacterium tuberculosis | Mycobacterium tuberculosis | NA | In vitro | PBMcs | NA | NA | β2-microglobulin gene knowckout mice, TAP-1 null mutant mice and HSP-65 immunized mice | NA | IFN-γ release increases | By CD8 T cell response | NA | None | None | 2002 | US 2002/013197 |
| antitb_1725 | SEQ ID NO 7 | SGSEAYQGVQQKWDA | Free | Free | None | Linear | 15 | L | NA | Protein Derived | From the proetins containing mycobacterial CD8 T cell epitopes | Mycobacterium tuberculosis | Mycobacterium tuberculosis | NA | In vitro | PBMcs | NA | NA | β2-microglobulin gene knowckout mice, TAP-1 null mutant mice and HSP-65 immunized mice | NA | IFN-γ release increases | By CD8 T cell response | NA | None | None | 2002 | US 2002/013197 |
| antitb_1726 | SEQ ID NO 8 | TATELNNAL | Free | Free | None | Linear | 9 | L | NA | Protein Derived | From the proetins containing mycobacterial CD8 T cell epitopes | Mycobacterium tuberculosis | Mycobacterium tuberculosis | NA | In vitro | PBMcs | NA | NA | β2-microglobulin gene knowckout mice, TAP-1 null mutant mice and HSP-65 immunized mice | NA | IFN-γ release increases | By CD8 T cell response | NA | None | None | 2002 | US 2002/013197 |
| antitb_1727 | SEQ ID NO 9 | RTISEAGQAM | Free | Free | None | Linear | 10 | L | NA | Protein Derived | From the proetins containing mycobacterial CD8 T cell epitopes | Mycobacterium tuberculosis | Mycobacterium tuberculosis | NA | In vitro | PBMcs | NA | NA | β2-microglobulin gene knowckout mice, TAP-1 null mutant mice and HSP-65 immunized mice | NA | IFN-γ release increases | By CD8 T cell response | NA | None | None | 2002 | US 2002/013197 |
| antitb_1728 | SEQ ID NO 10 | AYQGVQQKW | Free | Free | None | Linear | 9 | L | NA | Protein Derived | From the proetins containing mycobacterial CD8 T cell epitopes | Mycobacterium tuberculosis | Mycobacterium tuberculosis | NA | In vitro | PBMcs | NA | NA | β2-microglobulin gene knowckout mice, TAP-1 null mutant mice and HSP-65 immunized mice | NA | IFN-γ release increases | By CD8 T cell response | NA | None | None | 2002 | US 2002/013197 |
| antitb_1729 | SEQ ID NO 11 | SEAYQGVQQ | Free | Free | None | Linear | 9 | L | NA | Protein Derived | From the proetins containing mycobacterial CD8 T cell epitopes | Mycobacterium tuberculosis | Mycobacterium tuberculosis | NA | In vitro | PBMcs | NA | NA | β2-microglobulin gene knowckout mice, TAP-1 null mutant mice and HSP-65 immunized mice | NA | IFN-γ release increases | By CD8 T cell response | NA | None | None | 2002 | US 2002/013197 |