Browse result page of PRRDB 2.0
| PRRID | Name of Ligand | Source of ligand | Sequence of Ligand | Length of Ligand | Type of Ligand | Occurence | Role of Ligand | Name of Receptor | Type of Reeptor | Source of the Receptor | Localization | Domain | Sequence of Receptor | Swiss prot ID | Length of receptor | Function of Receptor | Assay used | PMID | Year of publication | Pubchem assay |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| PRRID_0340 | polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail | NA | C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O | NA | Nucleic Acid | Synthetic | Stilmulation leads to the activation of the IRF3. | RIG-1 | Rig-like receptor (RLR) | Human | Primary Human Keratinocytes | NA | O95786.fasta | O95786 | 925 | It is responsible for the antiviral defense status. | ELISA | 18684960 | 2008 | Pubchem Assay |
| PRRID_0340 | polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail | NA | C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O | NA | Nucleic Acid | Synthetic | Stilmulation leads to the activation of the IRF3. | RIG-1 | Rig-like receptor (RLR) | Human | Primary Human Keratinocytes | NA | O95786.fasta | O95786 | 925 | It is responsible for the antiviral defense status. | ELISA | 18684960 | 2008 | Pubchem Assay |
| PRRID_0341 | polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail | NA | C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O | NA | Nucleic Acid | Synthetic | Stilmulation leads to the activation of the IRF3 and NF- | MDA5 | Rig-like receptor (RLR) | Human | Primary Human Keratinocytes | NA | Q53TB6.fasta | Q53TB6 | 435 | It is responsible for the antiviral defense status. | ELISA | 18684960 | 2008 | Pubchem Assay |
| PRRID_0341 | polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail | NA | C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O | NA | Nucleic Acid | Synthetic | Stilmulation leads to the activation of the IRF3 and NF- | MDA5 | Rig-like receptor (RLR) | Human | Primary Human Keratinocytes | NA | Q53TB6.fasta | Q53TB6 | 435 | It is responsible for the antiviral defense status. | ELISA | 18684960 | 2008 | Pubchem Assay |
| PRRID_0343 | polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail | NA | C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O | NA | Nucleic Acid | Synthetic | Poly(I:C) stimulate the secretion of cytokines and chemokines such as, IL-6, RANTES/CCL5 and MCP-1/CCL2. | RIG-1 | Rig-like receptor (RLR) | Human | Mesothelial cells | NA | O95786.fasta | O95786 | 925 | It leads to the inflammation and infection of mesothelial cells. | ELISA | 19005739 | 2008 | Pubchem Assay |
| PRRID_0343 | polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail | NA | C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O | NA | Nucleic Acid | Synthetic | Poly(I:C) stimulate the secretion of cytokines and chemokines such as, IL-6, RANTES/CCL5 and MCP-1/CCL2. | RIG-1 | Rig-like receptor (RLR) | Human | Mesothelial cells | NA | O95786.fasta | O95786 | 925 | It leads to the inflammation and infection of mesothelial cells. | ELISA | 19005739 | 2008 | Pubchem Assay |
| PRRID_0344 | polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail | NA | C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O | NA | Nucleic Acid | Synthetic | Poly(I:C) stimulate the secretion of cytokines and chemokines such as, IL-6, RANTES/CCL5 and MCP-1/CCL2. | MDA5 | Rig-like receptor (RLR) | Human | Mesothelial cells | NA | Q53TB6.fasta | Q53TB6 | 435 | It leads to the inflammation and infection of mesothelial cells. | ELISA | 19005739 | 2008 | Pubchem Assay |
| PRRID_0344 | polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail | NA | C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O | NA | Nucleic Acid | Synthetic | Poly(I:C) stimulate the secretion of cytokines and chemokines such as, IL-6, RANTES/CCL5 and MCP-1/CCL2. | MDA5 | Rig-like receptor (RLR) | Human | Mesothelial cells | NA | Q53TB6.fasta | Q53TB6 | 435 | It leads to the inflammation and infection of mesothelial cells. | ELISA | 19005739 | 2008 | Pubchem Assay |
| PRRID_0354 | Viral RNA Click for more detail | Murine norovirus-1 (virus) | NA | NA | Nucleic Acid | Natural | Upon stimulation, it leads to the production of IFN-alpha, IL-6, MCP-1, TNFalpha and IFN-beta. | MDA5 | Rig-like receptor (RLR) | Mice | Bone marrow-derived DC | NA | Q8R5F7.fasta | Q8R5F7 | 1025 | MDA5 limits MNV-1 replication. | ELISA | 18636103 | 2008 | Pubchem Assay |
| PRRID_0354 | Viral RNA Click for more detail | Murine norovirus-1 (virus) | NA | NA | Nucleic Acid | Natural | Upon stimulation, it leads to the production of IFN-alpha, IL-6, MCP-1, TNFalpha and IFN-beta. | MDA5 | Rig-like receptor (RLR) | Mice | Bone marrow-derived DC | NA | Q8R5F7.fasta | Q8R5F7 | 1025 | MDA5 limits MNV-1 replication. | ELISA | 18636103 | 2008 | Pubchem Assay |
| PRRID_0402 | 3pRNA Click for more detail | NA | NA | NA | Nucleic Acid | Synthetic | Their binding leads to the enhanced production of IFN- | RIG-1 | Rig-like receptor (RLR) | Human | NK cells | NA | O95786.fasta | O95786 | 925 | It resulted in direct activation NK cells leading to high IFN-γ production in synergy with mDC-released soluble mediators induced by dsRNA | NA | 20639488 | 2010 | Pubchem Assay |
| PRRID_0402 | 3pRNA Click for more detail | NA | NA | NA | Nucleic Acid | Synthetic | Their binding leads to the enhanced production of IFN- | RIG-1 | Rig-like receptor (RLR) | Human | NK cells | NA | O95786.fasta | O95786 | 925 | It resulted in direct activation NK cells leading to high IFN-γ production in synergy with mDC-released soluble mediators induced by dsRNA | NA | 20639488 | 2010 | Pubchem Assay |
| PRRID_0403 | 5'-triphosphated RNA Click for more detail | Virus | NA | NA | Nucleic Acid | Natural | NA | RIG-1 | Rig-like receptor (RLR) | Mice (Murine) | Cytoplasm | NA | Q6Q899.fasta | Q6Q899 | 926 | NA | NA | 20739519 | 2010 | Pubchem Assay |
| PRRID_0403 | 5'-triphosphated RNA Click for more detail | Virus | NA | NA | Nucleic Acid | Natural | NA | RIG-1 | Rig-like receptor (RLR) | Mice (Murine) | Cytoplasm | NA | Q6Q899.fasta | Q6Q899 | 926 | NA | NA | 20739519 | 2010 | Pubchem Assay |
| PRRID_0472 | dsRNA Click for more detail | Virus | NA | NA | Nucleic Acid | Natural | NA | RIG-1 | Rig-like receptor (RLR) | Mice (Murine) | Cytoplasm | NA | Q6Q899.fasta | Q6Q899 | 926 | NA | NA | 20739519 | 2010 | Pubchem Assay |
| PRRID_0472 | dsRNA Click for more detail | Virus | NA | NA | Nucleic Acid | Natural | NA | RIG-1 | Rig-like receptor (RLR) | Mice (Murine) | Cytoplasm | NA | Q6Q899.fasta | Q6Q899 | 926 | NA | NA | 20739519 | 2010 | Pubchem Assay |
| PRRID_0473 | dsRNA Click for more detail | Virus | NA | NA | Nucleic Acid | Natural | NA | MDA5 | Rig-like receptor (RLR) | Mice (Murine) | Cytoplasm | NA | Q8R5F7.fasta | Q8R5F7 | 1025 | NA | NA | 20739519 | 2010 | Pubchem Assay |
| PRRID_0473 | dsRNA Click for more detail | Virus | NA | NA | Nucleic Acid | Natural | NA | MDA5 | Rig-like receptor (RLR) | Mice (Murine) | Cytoplasm | NA | Q8R5F7.fasta | Q8R5F7 | 1025 | NA | NA | 20739519 | 2010 | Pubchem Assay |
| PRRID_0476 | ds RNA with 5'-triphosphate end Click for more detail | Sendai (virus) | NA | NA | Nucleic Acid | Natural | It's binding activate type I IFN response | RIG-1 | Rig-like receptor (RLR) | NA | NA | NA | NA | NA | NA | It results into the anti-viral response by the immune system of host | NA | 20620129 | 2010 | NA |
| PRRID_0476 | ds RNA with 5'-triphosphate end Click for more detail | Sendai (virus) | NA | NA | Nucleic Acid | Natural | It's binding activate type I IFN response | RIG-1 | Rig-like receptor (RLR) | NA | NA | NA | NA | NA | NA | It results into the anti-viral response by the immune system of host | NA | 20620129 | 2010 | NA |
| PRRID_0477 | ds RNA with 5'-triphosphate end Click for more detail | Influenza A (virus) | NA | NA | Nucleic Acid | Natural | It's binding activate type I IFN response | RIG-1 | Rig-like receptor (RLR) | NA | NA | NA | NA | NA | NA | It results into the anti-viral response by the immune system of host | NA | 20620129 | 2010 | NA |
| PRRID_0477 | ds RNA with 5'-triphosphate end Click for more detail | Influenza A (virus) | NA | NA | Nucleic Acid | Natural | It's binding activate type I IFN response | RIG-1 | Rig-like receptor (RLR) | NA | NA | NA | NA | NA | NA | It results into the anti-viral response by the immune system of host | NA | 20620129 | 2010 | NA |
| PRRID_0597 | IVT-RNA Click for more detail | NA | NA | NA | Nucleic Acid | Synthetic | Upon recognition, these domains allow for CARD–CARD interaction with the mitochondrial adaptor proteins MAVS, which leads to the secretion of type-I interferons | RIG-1 | Rig-like receptor (RLR) | NA | NA | NA | NA | NA | NA | IFN triggers the expression of antiviral proteins, promote the destruction of infected cells by natural killer cells, and facilitate the production of neutralizing antibodies and cytotoxic T-cell responses. | NA | 20354786 | 2010 | NA |
| PRRID_0597 | IVT-RNA Click for more detail | NA | NA | NA | Nucleic Acid | Synthetic | Upon recognition, these domains allow for CARD–CARD interaction with the mitochondrial adaptor proteins MAVS, which leads to the secretion of type-I interferons | RIG-1 | Rig-like receptor (RLR) | NA | NA | NA | NA | NA | NA | IFN triggers the expression of antiviral proteins, promote the destruction of infected cells by natural killer cells, and facilitate the production of neutralizing antibodies and cytotoxic T-cell responses. | NA | 20354786 | 2010 | NA |
| PRRID_0712 | NS1 Click for more detail | Influenza A (virus) | MDPNTVSSFQVDCFLWHVRKRVADQELGDAPFLDRLRRDQKSLRGRGSTLGLDIETATRAGKQIVERILKEESDEALKMTMASVPASRYLTDMTLEEMSRHWFMLMPKQKVAGPLCIRMDQAIMDKNIILKANFSVIFDRLETLILLRAFTEEGTIVGEISPLPSLPGHTDEDVKNAVGVLIGGLEWNNNTVRVSETLQRFAWRSSNENGRPPLTPKQKRKMAGTIRSEV | 206 | Protein | Natural | Suppress of IRF3/7 activation | RIG-1 | Rig-like receptor (RLR) | Human | NA | NA | O95786.fasta | O95786 | 925 | Inhibit IFN production in mDC | NA | 20672047 | 2010 | Pubchem Assay |
| PRRID_0712 | NS1 Click for more detail | Influenza A (virus) | MDPNTVSSFQVDCFLWHVRKRVADQELGDAPFLDRLRRDQKSLRGRGSTLGLDIETATRAGKQIVERILKEESDEALKMTMASVPASRYLTDMTLEEMSRHWFMLMPKQKVAGPLCIRMDQAIMDKNIILKANFSVIFDRLETLILLRAFTEEGTIVGEISPLPSLPGHTDEDVKNAVGVLIGGLEWNNNTVRVSETLQRFAWRSSNENGRPPLTPKQKRKMAGTIRSEV | 206 | Protein | Natural | Suppress of IRF3/7 activation | RIG-1 | Rig-like receptor (RLR) | Human | NA | NA | O95786.fasta | O95786 | 925 | Inhibit IFN production in mDC | NA | 20672047 | 2010 | Pubchem Assay |
| PRRID_0714 | NS1, NS2 Click for more detail | Human respiratory syncytial virus (RSV) | MGCNSLSMIKVRLQNLFDNDEVALLKITCYTDKLILLTNALAKAAIHTIKLNGIVFIHVITSSEVCPDNNIVVKSNFTTMPILQNGGYIWELIELTHCSQLNGLMDDNCEIKFSKRLSDSVMTDYMNQISDLLGLDLNS, MDTTHNDTTPQRLIITDMRPLSLETIITSLTRDIITHKFIYLINHECIVRKLDERQATFTFLVNYEMKLLHKVGSTKYKKYTEYNTKYGTFPMPIFINHDGFLECIGIKPTKHTPIIYKYDLNP | 139, 124 | Protein | Natural | Suppress IRF3 activation | RIG-1 | Rig-like receptor (RLR) | Human | NA | NA | O95786.fasta | O95786 | 925 | Suppress IFN production in mDC | NA | 20672047 | 2010 | Pubchem Assay |
| PRRID_0714 | NS1, NS2 Click for more detail | Human respiratory syncytial virus (RSV) | MGCNSLSMIKVRLQNLFDNDEVALLKITCYTDKLILLTNALAKAAIHTIKLNGIVFIHVITSSEVCPDNNIVVKSNFTTMPILQNGGYIWELIELTHCSQLNGLMDDNCEIKFSKRLSDSVMTDYMNQISDLLGLDLNS, MDTTHNDTTPQRLIITDMRPLSLETIITSLTRDIITHKFIYLINHECIVRKLDERQATFTFLVNYEMKLLHKVGSTKYKKYTEYNTKYGTFPMPIFINHDGFLECIGIKPTKHTPIIYKYDLNP | 139, 124 | Protein | Natural | Suppress IRF3 activation | RIG-1 | Rig-like receptor (RLR) | Human | NA | NA | O95786.fasta | O95786 | 925 | Suppress IFN production in mDC | NA | 20672047 | 2010 | Pubchem Assay |
| PRRID_0763 | polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail | NA | C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O | NA | Nucleic Acid | Synthetic | Their binding leads to the enhanced production of type I IFNs | RIG-1 | Rig-like receptor (RLR) | Human | Nk cell and mDCs | NA | O95786.fasta | O95786 | 925 | It resulted in direct activation NK cells leading to high IFN-γ production in synergy with mDC-released soluble mediators induced by dsRNA | NA | 20639488 | 2010 | Pubchem Assay |
| PRRID_0763 | polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail | NA | C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O | NA | Nucleic Acid | Synthetic | Their binding leads to the enhanced production of type I IFNs | RIG-1 | Rig-like receptor (RLR) | Human | Nk cell and mDCs | NA | O95786.fasta | O95786 | 925 | It resulted in direct activation NK cells leading to high IFN-γ production in synergy with mDC-released soluble mediators induced by dsRNA | NA | 20639488 | 2010 | Pubchem Assay |
| PRRID_0764 | polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail | NA | C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O | NA | Nucleic Acid | Synthetic | Their binding leads to the enhanced production of type I IFNs | RIG-1 | Rig-like receptor (RLR) | Human | Nk cell and mDCs | NA | O95786.fasta | O95786 | 925 | It resulted in direct activation NK cells leading to high IFN-γ production in synergy with mDC-released soluble mediators induced by dsRNA | NA | 20639488 | 2010 | Pubchem Assay |
| PRRID_0764 | polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail | NA | C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O | NA | Nucleic Acid | Synthetic | Their binding leads to the enhanced production of type I IFNs | RIG-1 | Rig-like receptor (RLR) | Human | Nk cell and mDCs | NA | O95786.fasta | O95786 | 925 | It resulted in direct activation NK cells leading to high IFN-γ production in synergy with mDC-released soluble mediators induced by dsRNA | NA | 20639488 | 2010 | Pubchem Assay |
| PRRID_0767 | polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail | NA | C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O | NA | Nucleic Acid | Synthetic | It's binding activate type I IFN response | MDA5 | Rig-like receptor (RLR) | NA | NA | NA | NA | NA | NA | It results into the anti-viral response by the immune system of host | NA | 20620129 | 2010 | NA |
| PRRID_0767 | polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail | NA | C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O | NA | Nucleic Acid | Synthetic | It's binding activate type I IFN response | MDA5 | Rig-like receptor (RLR) | NA | NA | NA | NA | NA | NA | It results into the anti-viral response by the immune system of host | NA | 20620129 | 2010 | NA |
| PRRID_0771 | polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail | NA | C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O | NA | Nucleic Acid | Synthetic | Poly[I:C] stimulate the activaion of natural killer cells which leads to the secretion of IL-6 ,TNF-‚ç∫ and IFN- | MDA5 | Rig-like receptor (RLR) | Human | Natural Killer cells from peripheral blood | NA | Q53TB6.fasta | Q53TB6 | 435 | It has a immunostimulatory role | Flex-Set cytokine assay | 20427039 | 2010 | Pubchem Assay |
| PRRID_0771 | polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail | NA | C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O | NA | Nucleic Acid | Synthetic | Poly[I:C] stimulate the activaion of natural killer cells which leads to the secretion of IL-6 ,TNF-‚ç∫ and IFN- | MDA5 | Rig-like receptor (RLR) | Human | Natural Killer cells from peripheral blood | NA | Q53TB6.fasta | Q53TB6 | 435 | It has a immunostimulatory role | Flex-Set cytokine assay | 20427039 | 2010 | Pubchem Assay |
| PRRID_0772 | polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail | NA | C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O | NA | Nucleic Acid | Synthetic | Cells infected with viruses triggering MDA5-dependent IFN induction | RIG-1 | Rig-like receptor (RLR) | NA | NA | NA | NA | NA | NA | IFN triggers the expression of antiviral proteins, promote the destruction of infected cells by natural killer cells, and facilitate the production of neutralizing antibodies and cytotoxic T-cell responses. | NA | 20354786 | 2010 | NA |
| PRRID_0772 | polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail | NA | C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O | NA | Nucleic Acid | Synthetic | Cells infected with viruses triggering MDA5-dependent IFN induction | RIG-1 | Rig-like receptor (RLR) | NA | NA | NA | NA | NA | NA | IFN triggers the expression of antiviral proteins, promote the destruction of infected cells by natural killer cells, and facilitate the production of neutralizing antibodies and cytotoxic T-cell responses. | NA | 20354786 | 2010 | NA |
| PRRID_0778 | profilin-like protein Click for more detail | T. gondii (others) | MSDWDPVVKEWLVDTGYCCAGGIANAEDGVVFAAAADDDDGWSKLYKDDHEEDTIGEDGNACGKVSINEASTIKAAVDDGSAPNGVWIGGQKYKVVRPEKGFEYNDCTFDITMCARSKGGAHLIKTPNGSIVIALYDEEKEQDKGNSRTSALAFAEYLHQSGY | 163 | Protein | Natural | Upon recogniton by the TLR, it induces induces the recruitment of adaptor proteins MyD95 | MDA5 | Rig-like receptor (RLR) | Human | Cell surface | Leucine-rich Repeat (LRR) Domain | Q53TB6.fasta | Q53TB6 | 435 | It leadsto the secretion of the proinfalmmatory and IFN-‚ç∫ | NA | 20620129 | 2010 | Pubchem Assay |
| PRRID_0778 | profilin-like protein Click for more detail | T. gondii (others) | MSDWDPVVKEWLVDTGYCCAGGIANAEDGVVFAAAADDDDGWSKLYKDDHEEDTIGEDGNACGKVSINEASTIKAAVDDGSAPNGVWIGGQKYKVVRPEKGFEYNDCTFDITMCARSKGGAHLIKTPNGSIVIALYDEEKEQDKGNSRTSALAFAEYLHQSGY | 163 | Protein | Natural | Upon recogniton by the TLR, it induces induces the recruitment of adaptor proteins MyD95 | MDA5 | Rig-like receptor (RLR) | Human | Cell surface | Leucine-rich Repeat (LRR) Domain | Q53TB6.fasta | Q53TB6 | 435 | It leadsto the secretion of the proinfalmmatory and IFN-‚ç∫ | NA | 20620129 | 2010 | Pubchem Assay |
| PRRID_0833 | Viral RNA Click for more detail | Hepatitis C Virus (virus) | NA | NA | Nucleic Acid | Natural | The binding induces rapid interferon responses | RIG-1 | Rig-like receptor (RLR) | NA | NA | NA | NA | NA | NA | NA | NA | 20677943 | 2010 | NA |
| PRRID_0833 | Viral RNA Click for more detail | Hepatitis C Virus (virus) | NA | NA | Nucleic Acid | Natural | The binding induces rapid interferon responses | RIG-1 | Rig-like receptor (RLR) | NA | NA | NA | NA | NA | NA | NA | NA | 20677943 | 2010 | NA |
| PRRID_0835 | Viral RNA Click for more detail | Influenza A (virus) | NA | NA | Nucleic Acid | Natural | Upon virus recognition, these domains allow for CARD–CARD interaction with the mitochondrial adaptor proteins MAVS, which leads to the secretion of type-I interferons | RIG-1 | Rig-like receptor (RLR) | NA | NA | NA | NA | NA | NA | IFN triggers the expression of antiviral proteins, promote the destruction of infected cells by natural killer cells, and facilitate the production of neutralizing antibodies and cytotoxic T-cell responses. | NA | 20354786 | 2010 | NA |
| PRRID_0835 | Viral RNA Click for more detail | Influenza A (virus) | NA | NA | Nucleic Acid | Natural | Upon virus recognition, these domains allow for CARD–CARD interaction with the mitochondrial adaptor proteins MAVS, which leads to the secretion of type-I interferons | RIG-1 | Rig-like receptor (RLR) | NA | NA | NA | NA | NA | NA | IFN triggers the expression of antiviral proteins, promote the destruction of infected cells by natural killer cells, and facilitate the production of neutralizing antibodies and cytotoxic T-cell responses. | NA | 20354786 | 2010 | NA |
| PRRID_0934 | LyoVec Click for more detail | mimic of viral RNA (virus) | NA | NA | Nucleic Acid | Synthetic | elicit innate immune response | RIG-1 | Rig-like receptor (RLR) | Human | Eosinophils | NA | O95786.fasta | O95786 | 925 | NA | real-time reverse transcription-PCR, FACS, ELISA | 21978001 | 2011 | Pubchem Assay |
| PRRID_0934 | LyoVec Click for more detail | mimic of viral RNA (virus) | NA | NA | Nucleic Acid | Synthetic | elicit innate immune response | RIG-1 | Rig-like receptor (RLR) | Human | Eosinophils | NA | O95786.fasta | O95786 | 925 | NA | real-time reverse transcription-PCR, FACS, ELISA | 21978001 | 2011 | Pubchem Assay |
| PRRID_0938 | Oligosaccharides of hyaluronic acid (HA) Click for more detail | Endogenous (others) | CC(=O)NC1CC(C(OC1OC2C(C(C(OC2C(=O)[O-])O)O)O)CO)O | NA | Damage-associated molecular patterns (DAMPs) | Natural | the activation of TLR4 by hyaluronic acid leads to a different pattern of gene induction | MDA5 | Rig-like receptor (RLR) | Human | Myeloid cells, microglia, astrocytes, neurons | NA | Q53TB6.fasta | Q53TB6 | 435 | plays a fundamental role in pathogen recognition and activation of innate immunity | NA | 21982558 | 2011 | Pubchem Assay |
| PRRID_0938 | Oligosaccharides of hyaluronic acid (HA) Click for more detail | Endogenous (others) | CC(=O)NC1CC(C(OC1OC2C(C(C(OC2C(=O)[O-])O)O)O)CO)O | NA | Damage-associated molecular patterns (DAMPs) | Natural | the activation of TLR4 by hyaluronic acid leads to a different pattern of gene induction | MDA5 | Rig-like receptor (RLR) | Human | Myeloid cells, microglia, astrocytes, neurons | NA | Q53TB6.fasta | Q53TB6 | 435 | plays a fundamental role in pathogen recognition and activation of innate immunity | NA | 21982558 | 2011 | Pubchem Assay |
| PRRID_0950 | polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail | NA | C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O | NA | Nucleic Acid | Synthetic | elicit innate immune response | RIG-1 | Rig-like receptor (RLR) | Human | Eosinophils | NA | O95786.fasta | O95786 | 925 | mediate the efficient induction of the type I IFN response | real-time reverse transcription-PCR, FACS, ELISA | 21978001 | 2011 | Pubchem Assay |
| PRRID_0950 | polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail | NA | C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O | NA | Nucleic Acid | Synthetic | elicit innate immune response | RIG-1 | Rig-like receptor (RLR) | Human | Eosinophils | NA | O95786.fasta | O95786 | 925 | mediate the efficient induction of the type I IFN response | real-time reverse transcription-PCR, FACS, ELISA | 21978001 | 2011 | Pubchem Assay |
| PRRID_1176 | 5‚Ä- triphosphate ssRNA Click for more detail | Virus | NA | NA | Nucleic Acid | Natural | triggers immune responses | RIG-1 | Rig-like receptor (RLR) | Human | most adult tissues | helicase domain | O95786.fasta | O95786 | 925 | mediate the efficient induction of the type I IFN response. | NA | 24762827 | 2014 | Pubchem_assay |
| PRRID_1176 | 5‚Ä- triphosphate ssRNA Click for more detail | Virus | NA | NA | Nucleic Acid | Natural | triggers immune responses | RIG-1 | Rig-like receptor (RLR) | Human | most adult tissues | helicase domain | O95786.fasta | O95786 | 925 | mediate the efficient induction of the type I IFN response. | NA | 24762827 | 2014 | Pubchem_assay |
| PRRID_1613 | single-stranded RNA Click for more detail | Virus | NA | NA | Nucleic Acid | Synthetic | induce the production of proinflammatory cytokines in pDC | RIG-1 | Rig-like receptor (RLR) | Human | epithelial cells, myeloid cells, and CNS cells | Cytosol of cell | O95786.fasta | O95786 | 925 | Recognize distinct viruses and produce the antiviral immune changes that initiate an innate response | NA | 24829146 | 2014 | Pubchem_assay |
| PRRID_1613 | single-stranded RNA Click for more detail | Virus | NA | NA | Nucleic Acid | Synthetic | induce the production of proinflammatory cytokines in pDC | RIG-1 | Rig-like receptor (RLR) | Human | epithelial cells, myeloid cells, and CNS cells | Cytosol of cell | O95786.fasta | O95786 | 925 | Recognize distinct viruses and produce the antiviral immune changes that initiate an innate response | NA | 24829146 | 2014 | Pubchem_assay |
| PRRID_1894 | 5‚-dsRNA Click for more detail | EBOV, MV, SeV, NDV, RSV, flu virus, hantavirus,VSV, RV, HCV, JEV, adenovirus, vaccinia virus, HSV,L. | NA | NA | Nucleic Acid | Natural | K63-polyubiquitination/ polyubiquitin chain binding mediated receptor tetramerization | RIG-1 | Rig-like receptor (RLR) | Human | Cytoplasm, all mammalian cell types | NA | O95786.fasta | O95786 | 925 | MAVS-TRAF3-TBK1/ IKKe-IRF3. MAVS-FADD/ TRAF6-IKKs-NF-jB | NA | 28374903 | 2017 | Pubchem_assay |
| PRRID_1894 | 5‚-dsRNA Click for more detail | EBOV, MV, SeV, NDV, RSV, flu virus, hantavirus,VSV, RV, HCV, JEV, adenovirus, vaccinia virus, HSV,L. | NA | NA | Nucleic Acid | Natural | K63-polyubiquitination/ polyubiquitin chain binding mediated receptor tetramerization | RIG-1 | Rig-like receptor (RLR) | Human | Cytoplasm, all mammalian cell types | NA | O95786.fasta | O95786 | 925 | MAVS-TRAF3-TBK1/ IKKe-IRF3. MAVS-FADD/ TRAF6-IKKs-NF-jB | NA | 28374903 | 2017 | Pubchem_assay |
| PRRID_2216 | KIN 100 (7-acetyl- 6-propyl-3-[2-pyridinyl]-iso avone) Click for more detail | NA | NA | NA | Isoflavones & benzothiazoles | Synthetic | activity against hepatitis C | RIG-1 | Rig-like receptor (RLR) | Human | Cytoplasm | Carbohydrate recognition domain (CRD) | O95786.fasta | O95786 | 925 | NF-κB-mediated in ammatory cytokine pro- duction. | NA | 28776416 | 2017 | Pubchem_assay |
| PRRID_2216 | KIN 100 (7-acetyl- 6-propyl-3-[2-pyridinyl]-iso avone) Click for more detail | NA | NA | NA | Isoflavones & benzothiazoles | Synthetic | activity against hepatitis C | RIG-1 | Rig-like receptor (RLR) | Human | Cytoplasm | Carbohydrate recognition domain (CRD) | O95786.fasta | O95786 | 925 | NF-κB-mediated in ammatory cytokine pro- duction. | NA | 28776416 | 2017 | Pubchem_assay |
| PRRID_2217 | KIN 101 (4′-bromo-7-[sulfoxymethyl]-iso avone) Click for more detail | NA | NA | NA | Isoflavones & benzothiazoles | Synthetic | activity against influenza A virus. | RIG-1 | Rig-like receptor (RLR) | Human | Cytoplasm | Carbohydrate recognition domain (CRD) | O95786.fasta | O95786 | 925 | NF-κB-mediated in ammatory cytokine pro- duction. | NA | 28776416 | 2017 | Pubchem_assay |
| PRRID_2217 | KIN 101 (4′-bromo-7-[sulfoxymethyl]-iso avone) Click for more detail | NA | NA | NA | Isoflavones & benzothiazoles | Synthetic | activity against influenza A virus. | RIG-1 | Rig-like receptor (RLR) | Human | Cytoplasm | Carbohydrate recognition domain (CRD) | O95786.fasta | O95786 | 925 | NF-κB-mediated in ammatory cytokine pro- duction. | NA | 28776416 | 2017 | Pubchem_assay |
| PRRID_2218 | KIN 1400 Click for more detail | NA | NA | NA | hydroxyquinoline | Synthetic | able to inhibit replication of a broad spectrum of viruses (Flaviviridae, Filoviridae, Para- myxoviridae, Arenaviridae, and Orthomyxoviridae) to varying degrees by driving IRF3-dependent antiviral gene expression. | RIG-1 | Rig-like receptor (RLR) | Human | Cytoplasm | Carbohydrate recognition domain (CRD) | O95786.fasta | O95786 | 925 | NF-κB-mediated in ammatory cytokine pro- duction. | NA | 28776416 | 2017 | Pubchem_assay |
| PRRID_2218 | KIN 1400 Click for more detail | NA | NA | NA | hydroxyquinoline | Synthetic | able to inhibit replication of a broad spectrum of viruses (Flaviviridae, Filoviridae, Para- myxoviridae, Arenaviridae, and Orthomyxoviridae) to varying degrees by driving IRF3-dependent antiviral gene expression. | RIG-1 | Rig-like receptor (RLR) | Human | Cytoplasm | Carbohydrate recognition domain (CRD) | O95786.fasta | O95786 | 925 | NF-κB-mediated in ammatory cytokine pro- duction. | NA | 28776416 | 2017 | Pubchem_assay |
| PRRID_2309 | Long ds RNA Click for more detail | EMCV, poliovirus and coxasackie virus; Rotavirus, dengue virus, WNV, murine hepatitis virus(virus) | NA | NA | Pattern-associated molecular patterns (PAMPs) | Natural | filament formation mediated receptor tetramerization | MDA5 | Rig-like receptor (RLR) | Human | Cytoplasm, all mammalian cell types | NA | Q53TB6.fasta | Q53TB6 | 435 | MAVS-TRAF3-TBK1/ IKKe-IRF3. MAVS-FADD/ TRAF6-IKKs-NF-jB | NA | 28374903 | 2017 | Pubchem_assay |
| PRRID_2309 | Long ds RNA Click for more detail | EMCV, poliovirus and coxasackie virus; Rotavirus, dengue virus, WNV, murine hepatitis virus(virus) | NA | NA | Pattern-associated molecular patterns (PAMPs) | Natural | filament formation mediated receptor tetramerization | MDA5 | Rig-like receptor (RLR) | Human | Cytoplasm, all mammalian cell types | NA | Q53TB6.fasta | Q53TB6 | 435 | MAVS-TRAF3-TBK1/ IKKe-IRF3. MAVS-FADD/ TRAF6-IKKs-NF-jB | NA | 28374903 | 2017 | Pubchem_assay |
| PRRID_2558 | polydeoxyadenylic:polydeoxyt hymidylic acid (poly[dA:dT]) Click for more detail | Bacteria | CC1=CN(C(=O)NC1=O)C2CC(C(O2)COP(=O)(O)O)O.C1C(C(OC1N2C=NC3=C2N=CN=C3N)COP(=O)(O)O)O | NA | Nucleic Acid | Synthetic | The classic signaling cascade generated by RIG-I commences to the C-terminal repressor domain, followed by recruitment of mitochondrial antiviral signaling protein through homophilic interactions between CARD domains. | RIG-1 | Rig-like receptor (RLR) | Human | Cytoplasm | Carbohydrate recognition domain (CRD) | O95786.fasta | O95786 | 925 | NF-κB-mediated in ammatory cytokine pro- duction. | NA | 28776416 | 2017 | Pubchem_assay |
| PRRID_2558 | polydeoxyadenylic:polydeoxyt hymidylic acid (poly[dA:dT]) Click for more detail | Bacteria | CC1=CN(C(=O)NC1=O)C2CC(C(O2)COP(=O)(O)O)O.C1C(C(OC1N2C=NC3=C2N=CN=C3N)COP(=O)(O)O)O | NA | Nucleic Acid | Synthetic | The classic signaling cascade generated by RIG-I commences to the C-terminal repressor domain, followed by recruitment of mitochondrial antiviral signaling protein through homophilic interactions between CARD domains. | RIG-1 | Rig-like receptor (RLR) | Human | Cytoplasm | Carbohydrate recognition domain (CRD) | O95786.fasta | O95786 | 925 | NF-κB-mediated in ammatory cytokine pro- duction. | NA | 28776416 | 2017 | Pubchem_assay |
| PRRID_2561 | polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail | NA | C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O | NA | Nucleic Acid | Synthetic | NA | MDA5 | Rig-like receptor (RLR) | bat cell line | Cytosol | NA | NA | NA | NA | NA | RT-qPCR | 29122634 | 2017 | NA |
| PRRID_2561 | polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail | NA | C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O | NA | Nucleic Acid | Synthetic | NA | MDA5 | Rig-like receptor (RLR) | bat cell line | Cytosol | NA | NA | NA | NA | NA | RT-qPCR | 29122634 | 2017 | NA |
| PRRID_2565 | polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail | NA | C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O | NA | Nucleic Acid | Synthetic | The classic signaling cascade generated by RIG-I commences to the C-terminal repressor domain, followed by recruitment of mitochondrial antiviral signaling protein through homophilic interactions between CARD domains. | RIG-1 | Rig-like receptor (RLR) | Human | Cytoplasm | Carbohydrate recognition domain (CRD) | O95786.fasta | O95786 | 925 | NF-κB-mediated in ammatory cytokine pro- duction. | NA | 28776416 | 2017 | Pubchem_assay |
| PRRID_2565 | polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail | NA | C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O | NA | Nucleic Acid | Synthetic | The classic signaling cascade generated by RIG-I commences to the C-terminal repressor domain, followed by recruitment of mitochondrial antiviral signaling protein through homophilic interactions between CARD domains. | RIG-1 | Rig-like receptor (RLR) | Human | Cytoplasm | Carbohydrate recognition domain (CRD) | O95786.fasta | O95786 | 925 | NF-κB-mediated in ammatory cytokine pro- duction. | NA | 28776416 | 2017 | Pubchem_assay |
| PRRID_2584 | rb-dsRNA Click for more detail | Rice- bran (plant) | NA | NA | Pattern-associated molecular patterns (PAMPs) | Natural | activate caspase 1 via TRIF, resulting in the release of IL-1b and LDH | MDA5 | Rig-like receptor (RLR) | Mice | NA | NA | Q8R5F7.fasta | Q8R5F7 | 1025 | Caspase 1 activation is specifically induced by TLR3 signaling through TRIF/RIPK/ FADD. | RT-qPCR | 28848065 | 2017 | Pubchem_assay |
| PRRID_2584 | rb-dsRNA Click for more detail | Rice- bran (plant) | NA | NA | Pattern-associated molecular patterns (PAMPs) | Natural | activate caspase 1 via TRIF, resulting in the release of IL-1b and LDH | MDA5 | Rig-like receptor (RLR) | Mice | NA | NA | Q8R5F7.fasta | Q8R5F7 | 1025 | Caspase 1 activation is specifically induced by TLR3 signaling through TRIF/RIPK/ FADD. | RT-qPCR | 28848065 | 2017 | Pubchem_assay |
| PRRID_2614 | short dsRNA Click for more detail | EBOV, MV, SeV, NDV, RSV, flu virus, hantavirus,VSV, RV, HCV, JEV, adenovirus, vaccinia virus, HSV,L. | NA | NA | Pattern-associated molecular patterns (PAMPs) | Natural | K63-polyubiquitination/ polyubiquitin chain binding mediated receptor tetramerization | RIG-1 | Rig-like receptor (RLR) | Human | Cytoplasm, all mammalian cell types | NA | O95786.fasta | O95786 | 925 | MAVS-TRAF3-TBK1/ IKKe-IRF3. MAVS-FADD/ TRAF6-IKKs-NF-jB | NA | 28374903 | 2017 | Pubchem_assay |
| PRRID_2614 | short dsRNA Click for more detail | EBOV, MV, SeV, NDV, RSV, flu virus, hantavirus,VSV, RV, HCV, JEV, adenovirus, vaccinia virus, HSV,L. | NA | NA | Pattern-associated molecular patterns (PAMPs) | Natural | K63-polyubiquitination/ polyubiquitin chain binding mediated receptor tetramerization | RIG-1 | Rig-like receptor (RLR) | Human | Cytoplasm, all mammalian cell types | NA | O95786.fasta | O95786 | 925 | MAVS-TRAF3-TBK1/ IKKe-IRF3. MAVS-FADD/ TRAF6-IKKs-NF-jB | NA | 28374903 | 2017 | Pubchem_assay |
| PRRID_2686 | viral double stranded RNA Click for more detail | Virus | NA | NA | Nucleic Acid | Natural | NA | RIG-1 | Rig-like receptor (RLR) | NA | NA | NA | NA | NA | NA | NA | NA | 28801521 | 2017 | NA |
| PRRID_2686 | viral double stranded RNA Click for more detail | Virus | NA | NA | Nucleic Acid | Natural | NA | RIG-1 | Rig-like receptor (RLR) | NA | NA | NA | NA | NA | NA | NA | NA | 28801521 | 2017 | NA |
| PRRID_2687 | viral double stranded RNA Click for more detail | Virus | NA | NA | Nucleic Acid | Natural | NA | MDA5 | Rig-like receptor (RLR) | NA | NA | NA | NA | NA | NA | NA | NA | 28801521 | 2017 | NA |
| PRRID_2687 | viral double stranded RNA Click for more detail | Virus | NA | NA | Nucleic Acid | Natural | NA | MDA5 | Rig-like receptor (RLR) | NA | NA | NA | NA | NA | NA | NA | NA | 28801521 | 2017 | NA |
| PRRID_2692 | Viral sensor Click for more detail | Virus | NA | NA | NA | Natural | NA | RIG-1 (DDX58) | Rig-like receptor (RLR) | Human | NA | RIG-1-like receptor family | O95786.fasta | O95786 | 925 | NA | NA | 29066255 | 2017 | Pubchem_assay |
| PRRID_2692 | Viral sensor Click for more detail | Virus | NA | NA | NA | Natural | NA | RIG-1 (DDX58) | Rig-like receptor (RLR) | Human | NA | RIG-1-like receptor family | O95786.fasta | O95786 | 925 | NA | NA | 29066255 | 2017 | Pubchem_assay |