ID | PEPTIDE SEQUENCE | PEPTIDE NAME | LENGTH | CHIRALITY | LINEAR/CYCLIC | SOURCE | CATEGORY | N TERMINAL MODIFICATION | C TERMINAL MODIFICATION | CHEMICAL MODIFICATION | CARGO | PUBMED ID |
---|---|---|---|---|---|---|---|---|---|---|---|---|
2184 | KCFQWQRNMRKVRGPPVSCIKR | hLF R7A | 22 | L | Linear | Protein derived | Cationic | Conjugation with 5(6)-Carboxyfluorescein | Amidation | NA | Fluorophore (Fluorescein) | 24270856 |
2185 | KCFQWQRNMRKVRGPPVSCIKR | hLF R13A | 22 | L | Linear | Protein derived | Cationic | Conjugation with 5(6)-Carboxyfluorescein | Amidation | NA | Fluorophore (Fluorescein) | 24270856 |
2186 | KCFQWQRNMRKVRGPPVSCIKR | hLF R7A/V12R | 22 | L | Linear | Protein derived | Cationic | Conjugation with 5(6)-Carboxyfluorescein | Amidation | NA | Fluorophore (Fluorescein) | 24270856 |
2187 | KCFQWQRNMRKVRGPPVSCIKR | hLF R13A/P15R | 22 | L | Linear | Protein derived | Cationic | Conjugation with 5(6)-Carboxyfluorescein | Amidation | NA | Fluorophore (Fluorescein) | 24270856 |
2188 | KCFQWQRNMRKVRGPPVSCIKR | hLF +4R | 22 | L | Linear | Protein derived | Cationic | Conjugation with 5(6)-Carboxyfluorescein | Amidation | NA | Fluorophore (Fluorescein) | 24270856 |
2189 | KCFQWQRNMRKVRGPPVSCIKR | hLF lin+4R | 22 | L | Linear | Protein derived | Cationic | Conjugation with 5(6)-Carboxyfluorescein | Amidation | NA | Fluorophore (Fluorescein) | 24270856 |
2190 | KCFQWQRNMRKVRGPPVSCIKR | hLF R7 | 22 | L | Linear | Protein derived | Cationic | Conjugation with 5(6)-Carboxyfluorescein | Amidation | NA | Fluorophore (Fluorescein) | 24270856 |
2191 | KCFQWQRNMRKVRGPPVSCIKR | hLF K7 | 22 | L | Linear | Protein derived | Cationic | Conjugation with 5(6)-Carboxyfluorescein | Amidation | NA | Fluorophore (Fluorescein) | 24270856 |
2192 | K-Hey-FQWQRNMRKVRGPPVS-Hey-IKR | hLF Hcy | 20 | Modified | Linear | Protein derived | Cationic | Conjugation with 5(6)-Carboxyfluorescein | Amidation | hcy, homocysteine in which the side chain is one methylene group longer than in cysteine | Fluorophore (Fluorescein) | 24270856 |
2221 | YGRKKRRQRRR | EGFP-TAT | 11 | L | Linear | Protein derived | Cationic | Conjugated with EGFP | Free | NA | Protein (eGFP) | 24746937 |
2222 | RQIKIWFQNRRMKWKK | EGFP-Antp | 16 | L | Linear | Protein derived | Cationic and amphipathic | Conjugated with EGFP | Free | NA | Protein (eGFP) | 24746937 |
2223 | DAATARGRGRSAASRPTERPRAPARSASRPRRPVD | EGFP-VP_22 | 35 | L | Linear | Protein derived | Amphipathic | Conjugated with EGFP | Free | NA | Protein (eGFP) | 24746937 |
2224 | LLIILRRRIRKQAHAHSK | EGFP-pVEC | 18 | L | Linear | Protein derived | Amphipathic | Conjugated with EGFP | Free | NA | Protein (eGFP) | 24746937 |
2225 | GSVSRRRRRRGGRRRR | EGFP-LMWP | 16 | L | Linear | Protein derived | Cationic | Conjugated with EGFP | Free | NA | Protein (eGFP) | 24746937 |
2226 | LGTYTQDFNKFHTFPQTAIGVGAP | EGFP-hcT(9-32) | 24 | L | Linear | Protein derived | Amphipathic | Conjugated with EGFP | Free | NA | Protein (eGFP) | 24746937 |
2233 | CRQIKIWFQNRRMKWKK | Penetratin | 17 | L | Linear | Protein derived | Cationic and amphipathic | Acetylation | Amidation | NA | Peptide (KLA) and Nanoparticle (DSPC and DSPG liposomes) | 24796502 |
2239 | RKKNPNCRRH | hBCPP | 10 | L | Linear | Protein derived | Cationic | Free | Free | NA | Peptide (Smurf1-binding peptide) | 24831974 |
2242 | GRKKRRQRRRPPQY | Tat-Dex | 14 | L | Cyclic | Protein derived | Cationic | Free | Amidation | Dexamethasone | Dexamethasone | 24896852 |
2249 | RKKRRQRRR | Tat-PCP | 9 | L | Linear | Protein derived | Cationic | Acetylation | Amidation | Φ, L-2-naphthylalanine,miniPEG, 8-amino-3,6-dioxaoctanoic acid | Peptide [PCP, miniPEG-DE(pCAP)LI-NH2] | 24896852 |
2250 | RQIKIWFQNRRMKWKK | Antp-PCP | 16 | L | Linear | Protein derived | Cationic and amphipathic | Acetylation | Amidation | Φ, L-2-naphthylalanine,miniPEG, 8-amino-3,6-dioxaoctanoic acid | Peptide [PCP, miniPEG-DE(pCAP)LI-NH2] | 24896852 |
2268 | LCLRPVG | Xentry peptides | 7 | L | Linear | Protein derived | NA | Free | Free | NA | Fluorophore (FITC- and TAMRA) | 24811205 |
2269 | LCLRP | Xentry peptides | 5 | L | Linear | Protein derived | NA | Free | Free | NA | Fluorophore (FITC- and TAMRA) | 24811205 |
2270 | LCLR | Xentry peptides | 4 | L | Linear | Protein derived | NA | Free | Free | NA | Fluorophore (FITC- and TAMRA) | 24811205 |
2271 | LLR | Xentry peptides | 3 | L | Linear | Protein derived | NA | Free | Free | NA | Fluorophore (FITC- and TAMRA) | 24811205 |
2272 | LLLR | Xentry peptides | 4 | L | Linear | Protein derived | NA | Free | Free | NA | Fluorophore (FITC- and TAMRA) | 24811205 |
2273 | LLLLR | Xentry peptides | 5 | L | Linear | Protein derived | NA | Free | Free | NA | Fluorophore (FITC- and TAMRA) | 24811205 |
2274 | LLLRR | Xentry peptides | 5 | L | Linear | Protein derived | NA | Free | Free | NA | Fluorophore (FITC- and TAMRA) | 24811205 |
2275 | IIIR | Xentry peptides | 4 | L | Linear | Protein derived | NA | Free | Free | NA | Fluorophore (FITC- and TAMRA) | 24811205 |
2276 | VVVR | Xentry peptides | 4 | L | Linear | Protein derived | NA | Free | Free | NA | Fluorophore (FITC- and TAMRA) | 24811205 |
2277 | LCLK | Xentry peptides | 4 | L | Linear | Protein derived | NA | Free | Free | NA | Fluorophore (FITC- and TAMRA) | 24811205 |
2278 | LCLH | Xentry peptides | 4 | L | Linear | Protein derived | NA | Free | Free | NA | Fluorophore (FITC- and TAMRA) | 24811205 |
2279 | LCLE | Xentry peptides | 4 | L | Linear | Protein derived | NA | Free | Free | NA | Fluorophore (FITC- and TAMRA) | 24811205 |
2280 | LCLN | Xentry peptides | 4 | L | Linear | Protein derived | NA | Free | Free | NA | Fluorophore (FITC- and TAMRA) | 24811205 |
2281 | LCLQ | Xentry peptides | 4 | L | Linear | Protein derived | NA | Free | Free | NA | Fluorophore (FITC- and TAMRA) | 24811205 |
2282 | lclrpvg | Xentry peptides | 7 | D | Linear | Protein derived | NA | Free | Free | NA | Fluorophore (FITC- and TAMRA) | 24811205 |
2283 | lclrp | Xentry peptides | 5 | D | Linear | Protein derived | NA | Free | Free | NA | Fluorophore (FITC- and TAMRA) | 24811205 |
2284 | lclr | Xentry peptides | 4 | D | Linear | Protein derived | NA | Free | Free | NA | Fluorophore (FITC- and TAMRA) | 24811205 |
2285 | lcl | Xentry peptides | 3 | D | Linear | Protein derived | NA | Free | Free | NA | Fluorophore (FITC- and TAMRA) | 24811205 |
2286 | icir | Xentry peptides | 4 | D | Linear | Protein derived | NA | Free | Free | NA | Fluorophore (FITC- and TAMRA) | 24811205 |
2287 | vcvr | Xentry peptides | 4 | D | Linear | Protein derived | NA | Free | Free | NA | Fluorophore (FITC- and TAMRA) | 24811205 |
2288 | vlclr | Xentry peptides | 5 | D | Linear | Protein derived | NA | Free | Free | NA | Fluorophore (FITC- and TAMRA) | 24811205 |
2291 | YGRKKRRQRRR | P42-TAT | 11 | L | Linear | Protein derived | Cationic | Free | Free | NA | P42-TAT incorporated in a water-in-oil microemulsion | 25091984 |
2294 | RQIKIWFQNRRMKWKK | F(SG)4Pen | 16 | L | Linear | Protein derived | Cationic and amphipathic | Acetylation | Amidation | NA | Fluorophore (Alexa488), Protein (bovine serum albumin) and Nanoparticle (quantum dots) | 25108152 |
2295 | RQIKIWFQNRRMKWKK | G(SG)4Pen | 16 | L | Linear | Protein derived | Cationic and amphipathic | Acetylation | Amidation | NA | Fluorophore (Alexa488), Protein (bovine serum albumin) and Nanoparticle (quantum dots) | 25108152 |
2296 | AGYLLGKINLKALAALAKKIL | F(SG)4TP10 | 21 | L | Linear | Protein derived | Amphipathic | Acetylation | Amidation | NA | Fluorophore (Alexa488), Protein (bovine serum albumin) and Nanoparticle (quantum dots) | 25108152 |
2297 | AGYLLGKINLKALAALAKKIL | G(SG)4TP10 | 21 | L | Linear | Protein derived | Amphipathic | Acetylation | Amidation | NA | Fluorophore (Alexa488), Protein (bovine serum albumin) and Nanoparticle (quantum dots) | 25108152 |
2298 | RGDfK | cRGD | 5 | L | Cyclic | Protein derived | NA | Cycliclization | Cyclization | NA | Fluorophore (Alexa488), Protein (bovine serum albumin) and Nanoparticle (quantum dots) | 25108152 |
2303 | CGGKDCERRFSRSDQLKRHQRRHTGVKPFQ | b-WT1-pTj | 30 | L | Linear | Protein derived | Cationic | Biotinylation | Amidation | NA | Biotin | 24490140 |
2304 | KDCERRFSRSDQLKRHQRRHTGVKPFQK | FITC-WT1-pTj | 28 | L | Linear | Protein derived | Cationic | Free | NA | NA | Fluorophore (FITC) | 24490140 |
2311 | YGRKKRRQRRR | TAT(47-57) | 11 | L | Linear | Protein derived | Cationic | Free | Free | NA | Peptide (Mitochondrial Target Domain of NOXA) | 24416126 |