| ID | PEPTIDE SEQUENCE | PEPTIDE NAME | LENGTH | CHIRALITY | LINEAR/CYCLIC | SOURCE | CATEGORY | N TERMINAL MODIFICATION | C TERMINAL MODIFICATION | CHEMICAL MODIFICATION | CARGO | PUBMED ID |
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 2164 | PKKKRKVWKLLQQFFGLM | NS | 18 | L | Linear | Synthetic | Cationic | Free | Amidation | NA | Fluorophore (FITC) | 24958615 |
| 2165 | PKKKRKVWKLLQQFFGLM | Stearyl-NS | 18 | L | Linear | Synthetic | Cationic | Stearylation | Amidation | NA | Fluorophore (FITC) | 24958615 |
| 2166 | PKKKRKVWKLLQQFFGLM | FITC-NS | 18 | L | Linear | Synthetic | Cationic | Free | Amidation | Spacer 6-aminohexanoic acid (Ahx) | Fluorophore (FITC) | 24958615 |
| 2171 | GWTLNSAGYLLGKINLKALAALAKKIL | Transportan | 27 | L | Linear | Protein derived | Amphipathic | Conjugation with fluorescein | Amidation | NA | Fluorophore (Fluorescein) | 25016968 |
| 2172 | KLALKLALKALKAALKLA | MAP | 18 | L | Linear | Protein derived | Amphipathic | Conjugation with fluorescein | Amidation | NA | Fluorophore (Fluorescein) | 25016968 |
| 2173 | GRKKRRQRRRPPQ | pTat | 13 | L | Linear | Protein derived | Cationic | Conjugation with fluorescein | Amidation | NA | Fluorophore (Fluorescein) | 25016968 |
| 2174 | RQIKIWFQNRRMKWKK | pAntp | 16 | L | Linear | Protein derived | Cationic and amphipathic | Conjugation with fluorescein | Amidation | NA | Fluorophore (Fluorescein) | 25016968 |
| 2175 | RRRRRRRRR | Arg9 | 9 | L | Linear | Synthetic | Cationic | Conjugation with fluorescein | Amidation | NA | Fluorophore (Fluorescein) | 25016968 |
| 2176 | CSSLDEPGRGGFSSESKV | 1A | 18 | L | Linear | Protein derived | Cationic | Conjugation with fluorescein | Amidation | NA | Fluorophore (Fluorescein) | 25016968 |
| 2177 | AGYLLGKINLKALAALAKKIL | TP10 | 21 | L | Linear | Protein derived | Amphipathic | Conjugation with Oregon Green 488 | Amidation | NA | Fluorophore (Oregon Green 488) | 25016968 |
| 2178 | KCFQWQRNMRKVRGPPVSCIKR | hLF WT | 22 | L | Linear | Protein derived | Cationic | Conjugation with 5(6)-Carboxyfluorescein | Amidation | NA | Fluorophore (Fluorescein) | 24270856 |
| 2179 | KCFQWQRNMRKVRGPPVSCIKR | hLF W5A | 22 | L | Linear | Protein derived | Cationic | Conjugation with 5(6)-Carboxyfluorescein | Amidation | NA | Fluorophore (Fluorescein) | 24270856 |
| 2180 | KCFQWQRNMRKVRGPPVSCIKR | hLF Q6A | 22 | L | Linear | Protein derived | Cationic | Conjugation with 5(6)-Carboxyfluorescein | Amidation | NA | Fluorophore (Fluorescein) | 24270856 |
| 2181 | KCFQWQRNMRKVRGPPVSCIKR | hLF M9A | 22 | L | Linear | Protein derived | Cationic | Conjugation with 5(6)-Carboxyfluorescein | Amidation | NA | Fluorophore (Fluorescein) | 24270856 |
| 2182 | KCFQWQRNMRKVRGPPVSCIKR | hLF P15A | 22 | L | Linear | Protein derived | Cationic | Conjugation with 5(6)-Carboxyfluorescein | Amidation | NA | Fluorophore (Fluorescein) | 24270856 |
| 2183 | KCFQWQRNMRKVRGPPVSCIKR | hLF V12R | 22 | L | Linear | Protein derived | Cationic | Conjugation with 5(6)-Carboxyfluorescein | Amidation | NA | Fluorophore (Fluorescein) | 24270856 |
| 2184 | KCFQWQRNMRKVRGPPVSCIKR | hLF R7A | 22 | L | Linear | Protein derived | Cationic | Conjugation with 5(6)-Carboxyfluorescein | Amidation | NA | Fluorophore (Fluorescein) | 24270856 |
| 2185 | KCFQWQRNMRKVRGPPVSCIKR | hLF R13A | 22 | L | Linear | Protein derived | Cationic | Conjugation with 5(6)-Carboxyfluorescein | Amidation | NA | Fluorophore (Fluorescein) | 24270856 |
| 2186 | KCFQWQRNMRKVRGPPVSCIKR | hLF R7A/V12R | 22 | L | Linear | Protein derived | Cationic | Conjugation with 5(6)-Carboxyfluorescein | Amidation | NA | Fluorophore (Fluorescein) | 24270856 |
| 2187 | KCFQWQRNMRKVRGPPVSCIKR | hLF R13A/P15R | 22 | L | Linear | Protein derived | Cationic | Conjugation with 5(6)-Carboxyfluorescein | Amidation | NA | Fluorophore (Fluorescein) | 24270856 |
| 2188 | KCFQWQRNMRKVRGPPVSCIKR | hLF +4R | 22 | L | Linear | Protein derived | Cationic | Conjugation with 5(6)-Carboxyfluorescein | Amidation | NA | Fluorophore (Fluorescein) | 24270856 |
| 2189 | KCFQWQRNMRKVRGPPVSCIKR | hLF lin+4R | 22 | L | Linear | Protein derived | Cationic | Conjugation with 5(6)-Carboxyfluorescein | Amidation | NA | Fluorophore (Fluorescein) | 24270856 |
| 2190 | KCFQWQRNMRKVRGPPVSCIKR | hLF R7 | 22 | L | Linear | Protein derived | Cationic | Conjugation with 5(6)-Carboxyfluorescein | Amidation | NA | Fluorophore (Fluorescein) | 24270856 |
| 2191 | KCFQWQRNMRKVRGPPVSCIKR | hLF K7 | 22 | L | Linear | Protein derived | Cationic | Conjugation with 5(6)-Carboxyfluorescein | Amidation | NA | Fluorophore (Fluorescein) | 24270856 |
| 2192 | K-Hey-FQWQRNMRKVRGPPVS-Hey-IKR | hLF Hcy | 20 | Modified | Linear | Protein derived | Cationic | Conjugation with 5(6)-Carboxyfluorescein | Amidation | hcy, homocysteine in which the side chain is one methylene group longer than in cysteine | Fluorophore (Fluorescein) | 24270856 |
| 2211 | BRRXRRXRRX | FAM-1 | 10 | Modified | Linear | Synthetic | Amphipathic | FAM linked with beta-alanine | Amidation | B, Beta-Alanine; X, α-amino isobutyric acid | Fluorophore (FAM) | 24661993 |
| 2212 | BrrXrrXrrX | ent FAM-1 | 10 | Modified | Linear | Synthetic | Amphipathic | FAM linked with beta-alanine | Amidation | B, Beta-Alanine; X, α-amino isobutyric acid | Fluorophore (FAM) | 24661993 |
| 2213 | BRrXRrXRrX | FAM-2 | 10 | Modified | Linear | Synthetic | Amphipathic | FAM linked with beta-alanine | Amidation | B, Beta-Alanine; X, α-amino isobutyric acid | Fluorophore (FAM) | 24661993 |
| 2214 | BXRXRXXRXRXXRXRX | FAM-3 | 16 | Modified | Linear | Synthetic | Amphipathic | FAM linked with beta-alanine | Amidation | B, Beta-Alanine; X, α-amino isobutyric acid | Fluorophore (FAM) | 24661993 |
| 2215 | IPLVVPLRRRRRRRRC | RIPL | 16 | L | Linear | Chimeric | Cationic | Free | Free | RIPL peptides is conjugated to maleimide-derivatized liposomal vesicles via the thiol-maleimide reaction | Fluorophore (FITC) | 24704199 |
| 2216 | RRRRRRRRC | R8 | 9 | L | Linear | Synthetic | Cationic | Free | Free | NA | Fluorophore (FITC) | 24704199 |
| 2217 | IPLVVPLC | IPL | 8 | L | Linear | Synthetic | NA | Free | Free | NA | Fluorophore (FITC) | 24704199 |
| 2218 | KFLNRFWHWLQLKPGQPMY | IP-1 | 19 | L | Linear | Synthetic | Cationic | Free | Free | NA | Fluorophore (Hilytefluor 488 and TAMARA) | 24706763 |
| 2219 | KFLNRFWHWLQLKPGQPMY | TAMRA-IP-1 | 19 | L | Linear | Synthetic | Cationic | Free | Free | NA | Fluorophore (TAMRA) | 24706763 |
| 2220 | KFLNRFWHWLQLKPGQPMY | Hilytefluor 488-IP-1 | 19 | L | Linear | Synthetic | Cationic | Free | Free | NA | Fluorophore (Hilyteflour) | 24706763 |
| 2240 | Cyclo (FΦRRRRQ) | cFΦR4-Rho | 8 | Modified | Cyclic | Synthetic | Amphipathic | Free | Amidation | Φ, L-2-naphthylalanine | Fluorophore (Rhodamine), Protein (GFP) | 24896852 |
| 2243 | Cyclo(FΦRRRRQ) | cFΦR4-FITC | 8 | Modified | Cyclic | Synthetic | Amphipathic | Free | Amidation | Φ, L-2-naphthylalanine | Fluorophore (FITC) | 24896852 |
| 2257 | RRIRPRPPRLPRPRPRPLPFPRPG | Bac-ELP43 | 24 | L | Linear | Synthetic | Cationic | Free | Free | NA | Peptide [ELP (Elastin like peptide sequence), Fluorophore (Alexa-Fluor)] | 24866938 |
| 2258 | RRIRPRPPRLPRPRPRPLPFPRPG | Bac-ELP63 | 24 | L | Linear | Synthetic | Cationic | Free | Free | NA | Peptide [ELP (Elastin like peptide sequence), Fluorophore (Alexa-Fluor)] | 24866938 |
| 2259 | RRIRPRPPRLPRPRPRPLPFPRPG | Bac-ELP122 | 24 | L | Linear | Synthetic | Cationic | Free | Free | NA | Peptide [ELP (Elastin like peptide sequence), Fluorophore (Alexa-Fluor)] | 24866938 |
| 2260 | ISFDELLDYYGESGS | NYAD-41 | 15 | L | Linear | Synthetic | NA | Acetylation | Free | S5 [(S)-2-(4′-pentenyl)alanine] and R8 [(R)-2-(7′-octenyl)alanine] indicate stapling sites in the peptide sequence. | Fluorophore (FAM) | 24237936 |
| 2261 | ISF-R8-ELLDYY-S5-ESGS | NYAD-36 | 15 | L | Linear | Synthetic | NA | Acetylation | Amidation | S5 [(S)-2-(4′-pentenyl)alanine] and R8 [(R)-2-(7′-octenyl)alanine] indicate stapling sites in the peptide sequence. | Fluorophore (FAM) | 24237936 |
| 2262 | ISF-R8-ELLDYY-S5-ED | NYAD-66 | 13 | L | Linear | Synthetic | NA | Acetylation | Amidation | S5 [(S)-2-(4′-pentenyl)alanine] and R8 [(R)-2-(7′-octenyl)alanine] indicate stapling sites in the peptide sequence. | Fluorophore (FAM) | 24237936 |
| 2263 | ISF-R8-EWLQAY-S5-EDE | NYAD-67 | 14 | L | Linear | Synthetic | NA | Acetylation | Amidation | S5 [(S)-2-(4′-pentenyl)alanine] and R8 [(R)-2-(7′-octenyl)alanine] indicate stapling sites in the peptide sequence. | Fluorophore (FAM) | 24237936 |
| 2264 | PKKKRKV-AGYLLGKINLKALAALAKKIL-PQMQQNVFQYPGAGMVPQGEANF | TP10-SRC1LXXLL | 51 | L | Linear | Chimeric | Cationic | Conjugated with NLS | Free | NA | Fluorophore (FITC ) | 24705462 |
| 2265 | PKKKRKV-RRRRRRR-YSQTSHKLVQLLTTAEQQ | R7-SRC1LXXLL | 32 | L | Linear | Synthetic | Cationic | Conjugated with NLS | Free | NA | Fluorophore (FITC ) | 24705462 |
| 2266 | PKKKRKV-AGYLLGKINLKALAALAKKIL-PQMQQNVFQYPGAGMVPQGEANF | TP10-SRC1(1222-1245) | 51 | L | Linear | Chimeric | Cationic | Conjugated with NLS | Free | NA | Fluorophore (FITC ) | 24705462 |
| 2267 | PKKKRKV-RRRRRRR-PQMQQNVFQYPGAGMVPQGEANF | R7-SRC1(1222-1245) | 37 | L | Linear | Synthetic | Cationic | Conjugated with NLS | Free | NA | Fluorophore (FITC ) | 24705462 |
| 2268 | LCLRPVG | Xentry peptides | 7 | L | Linear | Protein derived | NA | Free | Free | NA | Fluorophore (FITC- and TAMRA) | 24811205 |
| 2269 | LCLRP | Xentry peptides | 5 | L | Linear | Protein derived | NA | Free | Free | NA | Fluorophore (FITC- and TAMRA) | 24811205 |