Browse result page of PRRDB 2.0

PRRID	Name of Ligand	Source of ligand	Sequence of Ligand	Length of Ligand	Type of Ligand	Occurence	Role of Ligand	Name of Receptor	Type of Reeptor	Source of the Receptor	Localization	Domain	Sequence of Receptor	Swiss prot ID	Length of receptor	Function of Receptor	Assay used	PMID	Year of publication	Pubchem assay
PRRID_1263	Endogenous RNA Click for more detail	RNA virus (Virus)	NA	NA	Nucleic Acid	Natural	triggers immune responses	Toll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Human	monocyte/macrophages, plasmacytoid DCs and B-lymphocytes	cell compartment	Q9NYK1.fasta	Q9NYK1	1049	Possible effect in case of stroke i.e it is Involved in preconditioning	NA	24807166	2014	Pubchem_assay
PRRID_1263	Endogenous RNA Click for more detail	RNA virus (Virus)	NA	NA	Nucleic Acid	Natural	triggers immune responses	Toll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Human	monocyte/macrophages, plasmacytoid DCs and B-lymphocytes	cell compartment	Q9NYK1.fasta	Q9NYK1	1049	Possible effect in case of stroke i.e it is Involved in preconditioning	NA	24807166	2014	Pubchem_assay
PRRID_1264	Endogenous RNA Click for more detail	RNA virus (Virus)	NA	NA	Nucleic Acid	Natural	triggers immune responses	Toll-like receptor 8 (TLR8)	Toll-like receptor (TLR)	Mice	monocyte/macrophages, DCs, mast cells	cell compartment	P58682.fasta	P58682	1032	important role in the immune response to viral infection	NA	24807166	2014	Pubchem_assay
PRRID_1264	Endogenous RNA Click for more detail	RNA virus (Virus)	NA	NA	Nucleic Acid	Natural	triggers immune responses	Toll-like receptor 8 (TLR8)	Toll-like receptor (TLR)	Mice	monocyte/macrophages, DCs, mast cells	cell compartment	P58682.fasta	P58682	1032	important role in the immune response to viral infection	NA	24807166	2014	Pubchem_assay
PRRID_1265	Endogenous RNA Click for more detail	RNA virus (Virus)	NA	NA	Nucleic Acid	Natural	triggers immune responses	Toll-like receptor 8 (TLR8)	Toll-like receptor (TLR)	Human	monocyte/macrophages, DCs, mast cells	cell compartment	Q9NR97.fasta	Q9NR97	1041	important role in the immune response to viral infection	NA	24807166	2014	Pubchem_assay
PRRID_1265	Endogenous RNA Click for more detail	RNA virus (Virus)	NA	NA	Nucleic Acid	Natural	triggers immune responses	Toll-like receptor 8 (TLR8)	Toll-like receptor (TLR)	Human	monocyte/macrophages, DCs, mast cells	cell compartment	Q9NR97.fasta	Q9NR97	1041	important role in the immune response to viral infection	NA	24807166	2014	Pubchem_assay
PRRID_1345	Host RNA Click for more detail	herpes simplex virus (virus)	NA	NA	Nucleic Acid	Natural	triggers immune responses	Toll-like receptor 3 (TLR3)	Toll-like receptor (TLR)	Mice	Dendritic Cell, B-lymphocyte	signaling occurs through an adapter protein Toll/IL-1 receptor domain-containing adaptor inducing IFN-b (TRIF)	Q99MB1.fasta	Q99MB1	905	induce type I interferons (IFN) and other cytokines production.	NA	24754320	2014	Pubchem_assay
PRRID_1345	Host RNA Click for more detail	herpes simplex virus (virus)	NA	NA	Nucleic Acid	Natural	triggers immune responses	Toll-like receptor 3 (TLR3)	Toll-like receptor (TLR)	Mice	Dendritic Cell, B-lymphocyte	signaling occurs through an adapter protein Toll/IL-1 receptor domain-containing adaptor inducing IFN-b (TRIF)	Q99MB1.fasta	Q99MB1	905	induce type I interferons (IFN) and other cytokines production.	NA	24754320	2014	Pubchem_assay
PRRID_1346	Host RNA Click for more detail	herpes simplex virus (virus)	NA	NA	Nucleic Acid	Natural	triggers immune responses	Toll-like receptor 3 (TLR3)	Toll-like receptor (TLR)	Human	Dendritic Cell, B-lymphocyte	signaling occurs through an adapter protein Toll/IL-1 receptor domain-containing adaptor inducing IFN-b (TRIF)	O15455.fasta	O15455	904	induce type I interferons (IFN) and other cytokines production.	NA	24754320	2014	Pubchem_assay
PRRID_1346	Host RNA Click for more detail	herpes simplex virus (virus)	NA	NA	Nucleic Acid	Natural	triggers immune responses	Toll-like receptor 3 (TLR3)	Toll-like receptor (TLR)	Human	Dendritic Cell, B-lymphocyte	signaling occurs through an adapter protein Toll/IL-1 receptor domain-containing adaptor inducing IFN-b (TRIF)	O15455.fasta	O15455	904	induce type I interferons (IFN) and other cytokines production.	NA	24754320	2014	Pubchem_assay
PRRID_1488	mRNA Click for more detail	RNA virus (Virus)	NA	NA	Nucleic Acid	Natural	triggers immune responses	Toll-like receptor 3 (TLR3)	Toll-like receptor (TLR)	Mice	Dendritic Cell, B-lymphocyte	Cell Compartment/Intracellular (Endosome)	Q99MB1.fasta	Q99MB1	905	induce type I interferons (IFN) and other cytokines production.	NA	24830024	2014	Pubchem_assay
PRRID_1488	mRNA Click for more detail	RNA virus (Virus)	NA	NA	Nucleic Acid	Natural	triggers immune responses	Toll-like receptor 3 (TLR3)	Toll-like receptor (TLR)	Mice	Dendritic Cell, B-lymphocyte	Cell Compartment/Intracellular (Endosome)	Q99MB1.fasta	Q99MB1	905	induce type I interferons (IFN) and other cytokines production.	NA	24830024	2014	Pubchem_assay
PRRID_1489	mRNA Click for more detail	RNA virus (Virus)	NA	NA	Nucleic Acid	Natural	triggers immune responses	Nucleotide Binding Oligomerization Domain Containing 2 (Nod2)	NOD-like receptor (NLR)	Mice	Dendritic Cell, B-lymphocyte	cell compartment	Q8K3Z0.fasta	Q8K3Z0	1020	Possible effect in case of stroke i.e it is Involved in preconditioning and No protection after gene knockout following cerebral ischemia	NA	24807166	2014	Pubchem_assay
PRRID_1489	mRNA Click for more detail	RNA virus (Virus)	NA	NA	Nucleic Acid	Natural	triggers immune responses	Nucleotide Binding Oligomerization Domain Containing 2 (Nod2)	NOD-like receptor (NLR)	Mice	Dendritic Cell, B-lymphocyte	cell compartment	Q8K3Z0.fasta	Q8K3Z0	1020	Possible effect in case of stroke i.e it is Involved in preconditioning and No protection after gene knockout following cerebral ischemia	NA	24807166	2014	Pubchem_assay
PRRID_1490	mRNA Click for more detail	RNA virus (Virus)	NA	NA	Nucleic Acid	Natural	triggers immune responses	Toll-like receptor 3 (TLR3)	Toll-like receptor (TLR)	Human	Dendritic Cell, B-lymphocyte	cell compartment	O15455.fasta	O15455	904	Possible effect in case of stroke i.e it is Involved in preconditioning and No protection after gene knockout following cerebral ischemia	NA	24807166	2014	Pubchem_assay
PRRID_1490	mRNA Click for more detail	RNA virus (Virus)	NA	NA	Nucleic Acid	Natural	triggers immune responses	Toll-like receptor 3 (TLR3)	Toll-like receptor (TLR)	Human	Dendritic Cell, B-lymphocyte	cell compartment	O15455.fasta	O15455	904	Possible effect in case of stroke i.e it is Involved in preconditioning and No protection after gene knockout following cerebral ischemia	NA	24807166	2014	Pubchem_assay
PRRID_1606	RNA Click for more detail	Enterovirus 71 (virus)	NA	NA	Nucleic Acid	Natural	The binding of ligand leads to the activation of the nuclear factor	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Mice	Dendritic cells	LRR	Q9NR96.fasta	Q9NR96	1032	This leads to the antiviral response against EV71	Cytokines assay	25078697	2014	Pubchem_assay
PRRID_1606	RNA Click for more detail	Enterovirus 71 (virus)	NA	NA	Nucleic Acid	Natural	The binding of ligand leads to the activation of the nuclear factor	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Mice	Dendritic cells	LRR	Q9NR96.fasta	Q9NR96	1032	This leads to the antiviral response against EV71	Cytokines assay	25078697	2014	Pubchem_assay
PRRID_1622	single-stranded RNA Click for more detail	RNA virus (Virus)	NA	NA	Nucleic Acid	Natural	triggers immune responses	Toll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Mice	monocyte/macrophages, plasmacytoid DCs and B-lymphocytes	cell compartment	P58681.fasta	P58681	1050	Possible effect in case of stroke i.e it is Involved in preconditioning	NA	24807166	2014	Pubchem_assay
PRRID_1622	single-stranded RNA Click for more detail	RNA virus (Virus)	NA	NA	Nucleic Acid	Natural	triggers immune responses	Toll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Mice	monocyte/macrophages, plasmacytoid DCs and B-lymphocytes	cell compartment	P58681.fasta	P58681	1050	Possible effect in case of stroke i.e it is Involved in preconditioning	NA	24807166	2014	Pubchem_assay
PRRID_1623	single-stranded RNA Click for more detail	RNA virus (Virus)	NA	NA	Nucleic Acid	Natural	triggers immune responses	Toll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Human	monocyte/macrophages, plasmacytoid DCs and B-lymphocytes	cell compartment	Q9NYK1.fasta	Q9NYK1	1049	Possible effect in case of stroke i.e it is Involved in preconditioning	NA	24807166	2014	Pubchem_assay
PRRID_1623	single-stranded RNA Click for more detail	RNA virus (Virus)	NA	NA	Nucleic Acid	Natural	triggers immune responses	Toll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Human	monocyte/macrophages, plasmacytoid DCs and B-lymphocytes	cell compartment	Q9NYK1.fasta	Q9NYK1	1049	Possible effect in case of stroke i.e it is Involved in preconditioning	NA	24807166	2014	Pubchem_assay
PRRID_1624	single-stranded RNA Click for more detail	RNA virus (Virus)	NA	NA	Nucleic Acid	Natural	triggers immune responses	Toll-like receptor 8 (TLR8)	Toll-like receptor (TLR)	Mice	monocyte/macrophages, DCs, mast cells	cell compartment	P58682.fasta	P58682	1032	important role in the immune response to viral infection	NA	24807166	2014	Pubchem_assay
PRRID_1624	single-stranded RNA Click for more detail	RNA virus (Virus)	NA	NA	Nucleic Acid	Natural	triggers immune responses	Toll-like receptor 8 (TLR8)	Toll-like receptor (TLR)	Mice	monocyte/macrophages, DCs, mast cells	cell compartment	P58682.fasta	P58682	1032	important role in the immune response to viral infection	NA	24807166	2014	Pubchem_assay
PRRID_1625	single-stranded RNA Click for more detail	RNA virus (Virus)	NA	NA	Nucleic Acid	Natural	triggers immune responses	Toll-like receptor 8 (TLR8)	Toll-like receptor (TLR)	Human	monocyte/macrophages, DCs, mast cells	cell compartment	Q9NR97.fasta	Q9NR97	1041	important role in the immune response to viral infection	NA	24807166	2014	Pubchem_assay
PRRID_1625	single-stranded RNA Click for more detail	RNA virus (Virus)	NA	NA	Nucleic Acid	Natural	triggers immune responses	Toll-like receptor 8 (TLR8)	Toll-like receptor (TLR)	Human	monocyte/macrophages, DCs, mast cells	cell compartment	Q9NR97.fasta	Q9NR97	1041	important role in the immune response to viral infection	NA	24807166	2014	Pubchem_assay
PRRID_1637	single-stranded RNA Click for more detail	herpes simplex virus (virus)	NA	NA	Nucleic Acid	Natural	elicit innate immune response	Toll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Mice	monocyte/macrophages, plasmacytoid DCs and B-lymphocytes	extracellular domains of leucine-rich repeat motifs	P58681.fasta	P58681	1050	important role in the immune response to viral infection	NA	24754320	2014	Pubchem_assay
PRRID_1637	single-stranded RNA Click for more detail	herpes simplex virus (virus)	NA	NA	Nucleic Acid	Natural	elicit innate immune response	Toll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Mice	monocyte/macrophages, plasmacytoid DCs and B-lymphocytes	extracellular domains of leucine-rich repeat motifs	P58681.fasta	P58681	1050	important role in the immune response to viral infection	NA	24754320	2014	Pubchem_assay
PRRID_1638	single-stranded RNA Click for more detail	herpes simplex virus (virus)	NA	NA	Nucleic Acid	Natural	elicit innate immune response	Toll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Human	monocyte/macrophages, plasmacytoid DCs and B-lymphocytes	extracellular domains of leucine-rich repeat motifs	Q9NYK1.fasta	Q9NYK1	1049	important role in the immune response to viral infection	NA	24754320	2014	Pubchem_assay
PRRID_1638	single-stranded RNA Click for more detail	herpes simplex virus (virus)	NA	NA	Nucleic Acid	Natural	elicit innate immune response	Toll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Human	monocyte/macrophages, plasmacytoid DCs and B-lymphocytes	extracellular domains of leucine-rich repeat motifs	Q9NYK1.fasta	Q9NYK1	1049	important role in the immune response to viral infection	NA	24754320	2014	Pubchem_assay
PRRID_1639	single-stranded RNA Click for more detail	herpes simplex virus (virus)	NA	NA	Nucleic Acid	Natural	elicit innate immune response	Toll-like receptor 8 (TLR8)	Toll-like receptor (TLR)	Mice	monocyte/macrophages, DCs, mast cells	extracellular domains of leucine-rich repeat motifs	P58682.fasta	P58682	1032	important role in the immune response to viral infection	NA	24754320	2014	Pubchem_assay
PRRID_1639	single-stranded RNA Click for more detail	herpes simplex virus (virus)	NA	NA	Nucleic Acid	Natural	elicit innate immune response	Toll-like receptor 8 (TLR8)	Toll-like receptor (TLR)	Mice	monocyte/macrophages, DCs, mast cells	extracellular domains of leucine-rich repeat motifs	P58682.fasta	P58682	1032	important role in the immune response to viral infection	NA	24754320	2014	Pubchem_assay
PRRID_1640	single-stranded RNA Click for more detail	herpes simplex virus (virus)	NA	NA	Nucleic Acid	Natural	elicit innate immune response	Toll-like receptor 8 (TLR8)	Toll-like receptor (TLR)	Human	monocyte/macrophages, DCs, mast cells	extracellular domains of leucine-rich repeat motifs	Q9NR97.fasta	Q9NR97	1041	important role in the immune response to viral infection	NA	24754320	2014	Pubchem_assay
PRRID_1640	single-stranded RNA Click for more detail	herpes simplex virus (virus)	NA	NA	Nucleic Acid	Natural	elicit innate immune response	Toll-like receptor 8 (TLR8)	Toll-like receptor (TLR)	Human	monocyte/macrophages, DCs, mast cells	extracellular domains of leucine-rich repeat motifs	Q9NR97.fasta	Q9NR97	1041	important role in the immune response to viral infection	NA	24754320	2014	Pubchem_assay
PRRID_1674	VTX-2337 Click for more detail	mimics viral single-stranded ribonucleic acid (ssRNA) (virus)	CCCN(CCC)C(=O)C1=CC2=C(C=C(C=C2)C3=CC=C(C=C3)C(=O)N4CCCC4)N=C(C1)N	NA	Pattern-associated molecular patterns (PAMPs)	Natural	stimulates TLR8	Toll-like receptor 8 (TLR8)	Toll-like receptor (TLR)	Mice (Murine)	TLR8 is expressed on mDCs, monocytes, and NK cells in humans	cell compartment	P58682.fasta	P58682	1032	TLR8 is expected to stimulate the release of distinct inflammatory mediators, including Th1- polarizing cytokines, chemokines, and other acute phase proteins	NA	24807889	2014	Pubchem_assay
PRRID_1674	VTX-2337 Click for more detail	mimics viral single-stranded ribonucleic acid (ssRNA) (virus)	CCCN(CCC)C(=O)C1=CC2=C(C=C(C=C2)C3=CC=C(C=C3)C(=O)N4CCCC4)N=C(C1)N	NA	Pattern-associated molecular patterns (PAMPs)	Natural	stimulates TLR8	Toll-like receptor 8 (TLR8)	Toll-like receptor (TLR)	Mice (Murine)	TLR8 is expressed on mDCs, monocytes, and NK cells in humans	cell compartment	P58682.fasta	P58682	1032	TLR8 is expected to stimulate the release of distinct inflammatory mediators, including Th1- polarizing cytokines, chemokines, and other acute phase proteins	NA	24807889	2014	Pubchem_assay
PRRID_1675	VTX-2337 Click for more detail	mimics viral single-stranded ribonucleic acid (ssRNA) (virus)	CCCN(CCC)C(=O)C1=CC2=C(C=C(C=C2)C3=CC=C(C=C3)C(=O)N4CCCC4)N=C(C1)N	NA	Pattern-associated molecular patterns (PAMPs)	Natural	stimulates TLR8	Toll-like receptor 8 (TLR8)	Toll-like receptor (TLR)	Human	TLR8 is expressed on mDCs, monocytes, and NK cells in humans	cell compartment	Q9NR97.fasta	Q9NR97	1041	TLR8 is expected to stimulate the release of distinct inflammatory mediators, including Th1- polarizing cytokines, chemokines, and other acute phase proteins	NA	24807889	2014	Pubchem_assay
PRRID_1675	VTX-2337 Click for more detail	mimics viral single-stranded ribonucleic acid (ssRNA) (virus)	CCCN(CCC)C(=O)C1=CC2=C(C=C(C=C2)C3=CC=C(C=C3)C(=O)N4CCCC4)N=C(C1)N	NA	Pattern-associated molecular patterns (PAMPs)	Natural	stimulates TLR8	Toll-like receptor 8 (TLR8)	Toll-like receptor (TLR)	Human	TLR8 is expressed on mDCs, monocytes, and NK cells in humans	cell compartment	Q9NR97.fasta	Q9NR97	1041	TLR8 is expected to stimulate the release of distinct inflammatory mediators, including Th1- polarizing cytokines, chemokines, and other acute phase proteins	NA	24807889	2014	Pubchem_assay
PRRID_1704	NS1 protein Click for more detail	Dengue virus(virus)	DMGYWIESEKNETWKLARASFIEVKTCIWPKSHTLWSNGVLESEMIIPKIYGGPISQHNYRPGYFTQTAGPWHLGKLELDFDLCEGTTVVVDEHCGNRGPSLRTTTVTGKIIHEWCCRSCTLPPLRFKGEDGCWYGM	137	Pattern-associated molecular patterns (PAMPs)	Natural	Immunostimulant	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Human	NA	NA	O00206.fasta	O00206	839	NA	NA	27293318	2016	Pubchem_assay
PRRID_1704	NS1 protein Click for more detail	Dengue virus(virus)	DMGYWIESEKNETWKLARASFIEVKTCIWPKSHTLWSNGVLESEMIIPKIYGGPISQHNYRPGYFTQTAGPWHLGKLELDFDLCEGTTVVVDEHCGNRGPSLRTTTVTGKIIHEWCCRSCTLPPLRFKGEDGCWYGM	137	Pattern-associated molecular patterns (PAMPs)	Natural	Immunostimulant	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Human	NA	NA	O00206.fasta	O00206	839	NA	NA	27293318	2016	Pubchem_assay
PRRID_1705	NS1 protein Click for more detail	Dengue virus(virus)	DMGYWIESEKNETWKLARASFIEVKTCIWPKSHTLWSNGVLESEMIIPKIYGGPISQHNYRPGYFTQTAGPWHLGKLELDFDLCEGTTVVVDEHCGNRGPSLRTTTVTGKIIHEWCCRSCTLPPLRFKGEDGCWYGM	137	Pattern-associated molecular patterns (PAMPs)	Natural	Immunostimulant	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	NA	NA	NA	NA	NA	NA	Activate NF-Kb	NA	27293318	2016	NA
PRRID_1705	NS1 protein Click for more detail	Dengue virus(virus)	DMGYWIESEKNETWKLARASFIEVKTCIWPKSHTLWSNGVLESEMIIPKIYGGPISQHNYRPGYFTQTAGPWHLGKLELDFDLCEGTTVVVDEHCGNRGPSLRTTTVTGKIIHEWCCRSCTLPPLRFKGEDGCWYGM	137	Pattern-associated molecular patterns (PAMPs)	Natural	Immunostimulant	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	NA	NA	NA	NA	NA	NA	Activate NF-Kb	NA	27293318	2016	NA
PRRID_1742	Fucose Click for more detail	HIV-1 (virus)	CC(C(C(C(C=O)O)O)O)O	NA	Carbohydrate	Natural	Immunostimulant	DCIR	C type Lectin (CTL/CLR)	Human	NA	NA	NA	NA	NA	Inhibition of APC functions such as cytokine production	NA	27999992	2016	NA
PRRID_1742	Fucose Click for more detail	HIV-1 (virus)	CC(C(C(C(C=O)O)O)O)O	NA	Carbohydrate	Natural	Immunostimulant	DCIR	C type Lectin (CTL/CLR)	Human	NA	NA	NA	NA	NA	Inhibition of APC functions such as cytokine production	NA	27999992	2016	NA
PRRID_1743	Fucose Click for more detail	S. pneumoniae, K. pneumoniae, C. albicans, P.carinii, HIV-1, Dengue virus	CC(C(C(C(C=O)O)O)O)O	NA	Carbohydrate	Natural	Immunostimulant	MMR	C type Lectin (CTL/CLR)	Human	NA	NA	NA	NA	NA	Pathogen recognition; Antigen uptake; Cell adhesion; Phagocytosis	NA	27999992	2016	NA
PRRID_1743	Fucose Click for more detail	S. pneumoniae, K. pneumoniae, C. albicans, P.carinii, HIV-1, Dengue virus	CC(C(C(C(C=O)O)O)O)O	NA	Carbohydrate	Natural	Immunostimulant	MMR	C type Lectin (CTL/CLR)	Human	NA	NA	NA	NA	NA	Pathogen recognition; Antigen uptake; Cell adhesion; Phagocytosis	NA	27999992	2016	NA
PRRID_1752	High-mannose and fucose glycans Click for more detail	Mycobacterium spp., H. pylori, Lactobacillus spp., Leishmania spp., HIV-1, Dengue virus, Measles vir	NA	NA	Pattern-associated molecular patterns (PAMPs)	Natural	Immunostimulant	DC-SIGN	C type Lectin (CTL/CLR)	Human	NA	NA	Q9H2X3.fasta	Q9H2X3	399	Pathogen recognition; Antigen uptake; APC/T cell interactions; Cell migration	NA	27999992	2016	Pubchem_assay
PRRID_1752	High-mannose and fucose glycans Click for more detail	Mycobacterium spp., H. pylori, Lactobacillus spp., Leishmania spp., HIV-1, Dengue virus, Measles vir	NA	NA	Pattern-associated molecular patterns (PAMPs)	Natural	Immunostimulant	DC-SIGN	C type Lectin (CTL/CLR)	Human	NA	NA	Q9H2X3.fasta	Q9H2X3	399	Pathogen recognition; Antigen uptake; APC/T cell interactions; Cell migration	NA	27999992	2016	Pubchem_assay
PRRID_1756	Lewis antigens Click for more detail	Mycobacterium spp., H. pylori, Lactobacillus spp., Leishmania spp., HIV-1, Dengue virus, Measles vir	CC1C(C(C(C(O1)OC2C(C(OC(C2OC3C(C(C(C(O3)CO)O)O)O)CO)O)NC(=O)C)O)O)O	NA	Pattern-associated molecular patterns (PAMPs)	Natural	Immunostimulant	DC-SIGN	C type Lectin (CTL/CLR)	Human	NA	NA	Q9H2X3.fasta	Q9H2X3	399	Pathogen recognition; Antigen uptake; APC/T cell interactions; Cell migration	NA	27999992	2016	Pubchem_assay
PRRID_1756	Lewis antigens Click for more detail	Mycobacterium spp., H. pylori, Lactobacillus spp., Leishmania spp., HIV-1, Dengue virus, Measles vir	CC1C(C(C(C(O1)OC2C(C(OC(C2OC3C(C(C(C(O3)CO)O)O)O)CO)O)NC(=O)C)O)O)O	NA	Pattern-associated molecular patterns (PAMPs)	Natural	Immunostimulant	DC-SIGN	C type Lectin (CTL/CLR)	Human	NA	NA	Q9H2X3.fasta	Q9H2X3	399	Pathogen recognition; Antigen uptake; APC/T cell interactions; Cell migration	NA	27999992	2016	Pubchem_assay
PRRID_1773	Lipopolysaccharide (LPS) Click for more detail	Laryngo- tracheitis virus (virus)	CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC	NA	Lipopolysaccharide (LPS)	Natural	Immunostimulant	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Birds	NA	NA	NA	NA	NA	TLR (LPS)-mediated, NO-dependent antiviral response in avian macrophage cell line	NA	27233799	2016	NA
PRRID_1773	Lipopolysaccharide (LPS) Click for more detail	Laryngo- tracheitis virus (virus)	CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC	NA	Lipopolysaccharide (LPS)	Natural	Immunostimulant	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Birds	NA	NA	NA	NA	NA	TLR (LPS)-mediated, NO-dependent antiviral response in avian macrophage cell line	NA	27233799	2016	NA
PRRID_1803	Mannose Click for more detail	HIV-1 (virus)	C(C1C(C(C(C(O1)O)O)O)O)O	NA	Pattern-associated molecular patterns (PAMPs)	Natural	Immunostimulant	DCIR	C type Lectin (CTL/CLR)	Human	NA	NA	NA	NA	NA	Inhibition of APC functions such as cytokine production	NA	27999992	2016	NA
PRRID_1803	Mannose Click for more detail	HIV-1 (virus)	C(C1C(C(C(C(O1)O)O)O)O)O	NA	Pattern-associated molecular patterns (PAMPs)	Natural	Immunostimulant	DCIR	C type Lectin (CTL/CLR)	Human	NA	NA	NA	NA	NA	Inhibition of APC functions such as cytokine production	NA	27999992	2016	NA
PRRID_1804	Mannose Click for more detail	S. pneumoniae, K. pneumoniae, C. albicans, P.carinii, HIV-1, Dengue virus	C(C1C(C(C(C(O1)O)O)O)O)O	NA	Pattern-associated molecular patterns (PAMPs)	Natural	Immunostimulant	MMR	C type Lectin (CTL/CLR)	Human	NA	NA	NA	NA	NA	Pathogen recognition; Antigen uptake; Cell adhesion; Phagocytosis	NA	27999992	2016	NA
PRRID_1804	Mannose Click for more detail	S. pneumoniae, K. pneumoniae, C. albicans, P.carinii, HIV-1, Dengue virus	C(C1C(C(C(C(O1)O)O)O)O)O	NA	Pattern-associated molecular patterns (PAMPs)	Natural	Immunostimulant	MMR	C type Lectin (CTL/CLR)	Human	NA	NA	NA	NA	NA	Pathogen recognition; Antigen uptake; Cell adhesion; Phagocytosis	NA	27999992	2016	NA
PRRID_1808	NA Click for more detail	RBIV (rock bream iridovirus)	NA	NA	NA	Natural	NA	OfLTL-2	Pattern recognition receptor (PRR)	Oplegnathus fasciatus	Liver and skin	B-lectin domain and two D-mannose	NA	NA	NA	activate NF-Œ∫B.	qRT-PCR	28144635	2016	NA
PRRID_1808	NA Click for more detail	RBIV (rock bream iridovirus)	NA	NA	NA	Natural	NA	OfLTL-2	Pattern recognition receptor (PRR)	Oplegnathus fasciatus	Liver and skin	B-lectin domain and two D-mannose	NA	NA	NA	activate NF-Œ∫B.	qRT-PCR	28144635	2016	NA
PRRID_1809	NA Click for more detail	RBIV (rock bream iridovirus)	NA	NA	NA	Natural	NA	OfLTL-3	Pattern recognition receptor (PRR)	Oplegnathus fasciatus	Liver and skin	B-lectin domain and two D-mannose	NA	NA	NA	activate NF-Œ∫B.	qRT-PCR	28144635	2016	NA
PRRID_1809	NA Click for more detail	RBIV (rock bream iridovirus)	NA	NA	NA	Natural	NA	OfLTL-3	Pattern recognition receptor (PRR)	Oplegnathus fasciatus	Liver and skin	B-lectin domain and two D-mannose	NA	NA	NA	activate NF-Œ∫B.	qRT-PCR	28144635	2016	NA
PRRID_1831	NA Click for more detail	viral hemorrhagic septicemia (virus)	NA	NA	Pattern-associated molecular patterns (PAMPs)	Natural	Immunostimulant	EcToll-like receptor 2b (TLR2b)	Toll-like receptor (TLR)	Zebrafish	Gills and spleen	leucine-rich repeat (LRR) domains (including an LRR-NT (except for EcTLR1b), several LRR motifs and an LRR-CT), a trans-membrane region and a Toll/interleukin-1 receptor (TIR) domain.	NA	NA	NA	Activate NF-Kb	NA	27037219	2016	NA
PRRID_1831	NA Click for more detail	viral hemorrhagic septicemia (virus)	NA	NA	Pattern-associated molecular patterns (PAMPs)	Natural	Immunostimulant	EcToll-like receptor 2b (TLR2b)	Toll-like receptor (TLR)	Zebrafish	Gills and spleen	leucine-rich repeat (LRR) domains (including an LRR-NT (except for EcTLR1b), several LRR motifs and an LRR-CT), a trans-membrane region and a Toll/interleukin-1 receptor (TIR) domain.	NA	NA	NA	Activate NF-Kb	NA	27037219	2016	NA
PRRID_1834	Nucleic acid Click for more detail	H9N2(Avian influezna virus) (virus)	NA	NA	Pattern-associated molecular patterns (PAMPs)	Natural	Causes Avian influenza and act as immunostimulant for TLR.	goToll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Waterfowl	lungs	TIR domain	NA	NA	NA	Proliferation of cytokines and activation of NF-kB	qRT-PCR	27832963	2016	NA
PRRID_1834	Nucleic acid Click for more detail	H9N2(Avian influezna virus) (virus)	NA	NA	Pattern-associated molecular patterns (PAMPs)	Natural	Causes Avian influenza and act as immunostimulant for TLR.	goToll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Waterfowl	lungs	TIR domain	NA	NA	NA	Proliferation of cytokines and activation of NF-kB	qRT-PCR	27832963	2016	NA
PRRID_1835	Nucleic acid Click for more detail	Newcastle Disease Virus (virus)	NA	NA	Pattern-associated molecular patterns (PAMPs)	Natural	Causes Newcastle disease and act as immunostimulant for TLR.	goToll-like receptor 21 (TLR21)	Toll-like receptor (TLR)	Waterfowl	Endoplasmic recticulum	TIR domain	NA	NA	NA	Proliferation of cytokines and activation of NF-kB	qRT-PCR	27832963	2016	NA
PRRID_1835	Nucleic acid Click for more detail	Newcastle Disease Virus (virus)	NA	NA	Pattern-associated molecular patterns (PAMPs)	Natural	Causes Newcastle disease and act as immunostimulant for TLR.	goToll-like receptor 21 (TLR21)	Toll-like receptor (TLR)	Waterfowl	Endoplasmic recticulum	TIR domain	NA	NA	NA	Proliferation of cytokines and activation of NF-kB	qRT-PCR	27832963	2016	NA
PRRID_1868	sialyl-Lex Click for more detail	S. pneumoniae, K. pneumoniae, C. albicans, P.carinii, HIV-1, Dengue virus	NA	NA	Pattern-associated molecular patterns (PAMPs)	Natural	Immunostimulant	MMR	C type Lectin (CTL/CLR)	Human	NA	NA	NA	NA	NA	Pathogen recognition; Antigen uptake; Cell adhesion; Phagocytosis	NA	27999992	2016	NA
PRRID_1868	sialyl-Lex Click for more detail	S. pneumoniae, K. pneumoniae, C. albicans, P.carinii, HIV-1, Dengue virus	NA	NA	Pattern-associated molecular patterns (PAMPs)	Natural	Immunostimulant	MMR	C type Lectin (CTL/CLR)	Human	NA	NA	NA	NA	NA	Pathogen recognition; Antigen uptake; Cell adhesion; Phagocytosis	NA	27999992	2016	NA
PRRID_1883	VP19 WSSV envelope protein Click for more detail	white spot syndrome virus (WSSV)	NA	NA	Pattern-associated molecular patterns (PAMPs)	Natural	Immunostimulant	MjSRC	Scavenger receptor (SR)	Marsupenaeus japonicus	Hemocytes	two CCP domains, a MAM domain, a transmembrane region and an intracellular region	A0A1L2DC21.fasta	A0A1L2DC21	692	antiviral role by enhancing hemo- cytes phagocytosis of WSSV in shrimp.	NA	28027319	2016	Pubchem_assay
PRRID_1883	VP19 WSSV envelope protein Click for more detail	white spot syndrome virus (WSSV)	NA	NA	Pattern-associated molecular patterns (PAMPs)	Natural	Immunostimulant	MjSRC	Scavenger receptor (SR)	Marsupenaeus japonicus	Hemocytes	two CCP domains, a MAM domain, a transmembrane region and an intracellular region	A0A1L2DC21.fasta	A0A1L2DC21	692	antiviral role by enhancing hemo- cytes phagocytosis of WSSV in shrimp.	NA	28027319	2016	Pubchem_assay
PRRID_1894	5‚-dsRNA Click for more detail	EBOV, MV, SeV, NDV, RSV, flu virus, hantavirus,VSV, RV, HCV, JEV, adenovirus, vaccinia virus, HSV,L.	NA	NA	Nucleic Acid	Natural	K63-polyubiquitination/ polyubiquitin chain binding mediated receptor tetramerization	RIG-1	Rig-like receptor (RLR)	Human	Cytoplasm, all mammalian cell types	NA	O95786.fasta	O95786	925	MAVS-TRAF3-TBK1/ IKKe-IRF3. MAVS-FADD/ TRAF6-IKKs-NF-jB	NA	28374903	2017	Pubchem_assay
PRRID_1894	5‚-dsRNA Click for more detail	EBOV, MV, SeV, NDV, RSV, flu virus, hantavirus,VSV, RV, HCV, JEV, adenovirus, vaccinia virus, HSV,L.	NA	NA	Nucleic Acid	Natural	K63-polyubiquitination/ polyubiquitin chain binding mediated receptor tetramerization	RIG-1	Rig-like receptor (RLR)	Human	Cytoplasm, all mammalian cell types	NA	O95786.fasta	O95786	925	MAVS-TRAF3-TBK1/ IKKe-IRF3. MAVS-FADD/ TRAF6-IKKs-NF-jB	NA	28374903	2017	Pubchem_assay
PRRID_1916	analog poly I:C Click for more detail	MCMV, HSV-1, EMCV, WNV,and enteroviruses (virus)	NA	NA	Pattern-associated molecular patterns (PAMPs)	Synthetic	dsRNA induced dimerization	Toll-like receptor 3 (TLR3)	Toll-like receptor (TLR)	Human	Endosomes. Innate immune cells except neutrophils and pDCs	Leucine-rich Repeat (LRR) Domain	O15455.fasta	O15455	904	TRIF-TRAF3-TBK1/ IKKe-IRF3. TRIF-TRAF6- IKKs-NF-jB	NA	28374903	2017	Pubchem_assay
PRRID_1916	analog poly I:C Click for more detail	MCMV, HSV-1, EMCV, WNV,and enteroviruses (virus)	NA	NA	Pattern-associated molecular patterns (PAMPs)	Synthetic	dsRNA induced dimerization	Toll-like receptor 3 (TLR3)	Toll-like receptor (TLR)	Human	Endosomes. Innate immune cells except neutrophils and pDCs	Leucine-rich Repeat (LRR) Domain	O15455.fasta	O15455	904	TRIF-TRAF3-TBK1/ IKKe-IRF3. TRIF-TRAF6- IKKs-NF-jB	NA	28374903	2017	Pubchem_assay
PRRID_1952	Bacterial MDP Click for more detail	RSV, IAV, and HCMV (virus)	NA	NA	Pattern-associated molecular patterns (PAMPs)	Natural	Likely tetramerization into washer- locker structure	Nucleotide Binding Oligomerization Domain Containing 2 (Nod2)	NOD-like receptor (NLR)	Human	Cytoplasm. Macrophages, monocytes, Paneth cells, DCs	NA	Q9HC29.fasta	Q9HC29	1040	RIP2-IKKs-NF-jB	NA	28374903	2017	Pubchem_assay
PRRID_1952	Bacterial MDP Click for more detail	RSV, IAV, and HCMV (virus)	NA	NA	Pattern-associated molecular patterns (PAMPs)	Natural	Likely tetramerization into washer- locker structure	Nucleotide Binding Oligomerization Domain Containing 2 (Nod2)	NOD-like receptor (NLR)	Human	Cytoplasm. Macrophages, monocytes, Paneth cells, DCs	NA	Q9HC29.fasta	Q9HC29	1040	RIP2-IKKs-NF-jB	NA	28374903	2017	Pubchem_assay
PRRID_1983	CL075 Click for more detail	SeV, flu virus, coxsackie virus, vaccinia virus, MV, RSV, retrovirus (virus)	CCCC1=NC2=C(S1)C3=CC=CC=C3N=C2N	NA	Pattern-associated molecular patterns (PAMPs)	Synthetic	Z-loop proteolytic cleavage, and receptor dimer conformational change	Toll-like receptor 8 (TLR8)	Toll-like receptor (TLR)	Human	Endosomes. Monocytes, macrophages and cDCs	Leucine-rich Repeat (LRR) Domain	Q9NR97.fasta	Q9NR97	1041	MyD88-IRAK4/ IRAK1-IRAF6- IKKs-NF-jB	NA	28374903	2017	Pubchem_assay
PRRID_1983	CL075 Click for more detail	SeV, flu virus, coxsackie virus, vaccinia virus, MV, RSV, retrovirus (virus)	CCCC1=NC2=C(S1)C3=CC=CC=C3N=C2N	NA	Pattern-associated molecular patterns (PAMPs)	Synthetic	Z-loop proteolytic cleavage, and receptor dimer conformational change	Toll-like receptor 8 (TLR8)	Toll-like receptor (TLR)	Human	Endosomes. Monocytes, macrophages and cDCs	Leucine-rich Repeat (LRR) Domain	Q9NR97.fasta	Q9NR97	1041	MyD88-IRAK4/ IRAK1-IRAF6- IKKs-NF-jB	NA	28374903	2017	Pubchem_assay
PRRID_1984	CL097 Click for more detail	SeV, flu virus, coxsackie virus, vaccinia virus, MV, RSV, retrovirus (virus)	CCOCC1=NC2=C(N1)C(=NC3=CC=CC=C32)N	NA	Nucleic Acid	Synthetic	Z-loop proteolytic cleavage, and receptor dimer conformational change	Toll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Human	Endosomes. pDCs and B cells	Leucine-rich Repeat (LRR) Domain	Q9NYK1.fasta	Q9NYK1	1049	MyD88-IRAK4/ IRAK1-IRF7. MyD88-IRAF6- IKKs-NF-jB	NA	28374903	2017	Pubchem_assay
PRRID_1984	CL097 Click for more detail	SeV, flu virus, coxsackie virus, vaccinia virus, MV, RSV, retrovirus (virus)	CCOCC1=NC2=C(N1)C(=NC3=CC=CC=C32)N	NA	Nucleic Acid	Synthetic	Z-loop proteolytic cleavage, and receptor dimer conformational change	Toll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Human	Endosomes. pDCs and B cells	Leucine-rich Repeat (LRR) Domain	Q9NYK1.fasta	Q9NYK1	1049	MyD88-IRAK4/ IRAK1-IRF7. MyD88-IRAF6- IKKs-NF-jB	NA	28374903	2017	Pubchem_assay
PRRID_1985	CL097 Click for more detail	SeV, flu virus, coxsackie virus, vaccinia virus, MV, RSV, retrovirus (virus)	CCOCC1=NC2=C(N1)C(=NC3=CC=CC=C32)N	NA	Nucleic Acid	Synthetic	Z-loop proteolytic cleavage, and receptor dimer conformational change	Toll-like receptor 8 (TLR8)	Toll-like receptor (TLR)	Human	Endosomes. Monocytes, macrophages and cDCs	Leucine-rich Repeat (LRR) Domain	Q9NR97.fasta	Q9NR97	1041	MyD88-IRAK4/ IRAK1-IRAF6- IKKs-NF-jB	NA	28374903	2017	Pubchem_assay
PRRID_1985	CL097 Click for more detail	SeV, flu virus, coxsackie virus, vaccinia virus, MV, RSV, retrovirus (virus)	CCOCC1=NC2=C(N1)C(=NC3=CC=CC=C32)N	NA	Nucleic Acid	Synthetic	Z-loop proteolytic cleavage, and receptor dimer conformational change	Toll-like receptor 8 (TLR8)	Toll-like receptor (TLR)	Human	Endosomes. Monocytes, macrophages and cDCs	Leucine-rich Repeat (LRR) Domain	Q9NR97.fasta	Q9NR97	1041	MyD88-IRAK4/ IRAK1-IRAF6- IKKs-NF-jB	NA	28374903	2017	Pubchem_assay
PRRID_2009	dsRNA Click for more detail	Hepatitis C Virus (virus)	NA	NA	Nucleic Acid	Natural	Activation of NOD1	Nucleotide Binding Oligomerization Domain Containing 1 (Nod1)	NOD-like receptor (NLR)	Mice	Macrophages	nucleotide-binding oligomerization domain	Q8BHB0.fasta	Q8BHB0	953	Independent of MAVS; likely dsRNA produced by NS5B polymerase	NA	28823510	2017	Pubchem_assay
PRRID_2009	dsRNA Click for more detail	Hepatitis C Virus (virus)	NA	NA	Nucleic Acid	Natural	Activation of NOD1	Nucleotide Binding Oligomerization Domain Containing 1 (Nod1)	NOD-like receptor (NLR)	Mice	Macrophages	nucleotide-binding oligomerization domain	Q8BHB0.fasta	Q8BHB0	953	Independent of MAVS; likely dsRNA produced by NS5B polymerase	NA	28823510	2017	Pubchem_assay
PRRID_2011	dsRNA Click for more detail	MCMV, HSV-1, EMCV, WNV,and enteroviruses (virus)	NA	NA	Nucleic Acid	Natural	dsRNA induced dimerization	NA	NA	solanaceous	NA	NA	NA	NA	NA	TRIF-TRAF3-TBK1/ IKKe-IRF3. TRIF-TRAF6- IKKs-NF-jB	NA	28374903	2017	NA
PRRID_2011	dsRNA Click for more detail	MCMV, HSV-1, EMCV, WNV,and enteroviruses (virus)	NA	NA	Nucleic Acid	Natural	dsRNA induced dimerization	NA	NA	solanaceous	NA	NA	NA	NA	NA	TRIF-TRAF3-TBK1/ IKKe-IRF3. TRIF-TRAF6- IKKs-NF-jB	NA	28374903	2017	NA
PRRID_2012	dsRNA Click for more detail	flu virus, SeV and bacteria	NA	NA	Nucleic Acid	Natural	potassium efflux-NEK7 involved NLRP3 inflammasome complex	Nod-like receptor P3 (NLRP3)	NOD-like receptor (NLR)	Human	Cytoplasm. Ubiquitously expressed	NA	Q96P20.fasta	Q96P20	1036	ASC-inflammasome- caspase-1-IL-1/IL-18	NA	28374903	2017	Pubchem_assay
PRRID_2012	dsRNA Click for more detail	flu virus, SeV and bacteria	NA	NA	Nucleic Acid	Natural	potassium efflux-NEK7 involved NLRP3 inflammasome complex	Nod-like receptor P3 (NLRP3)	NOD-like receptor (NLR)	Human	Cytoplasm. Ubiquitously expressed	NA	Q96P20.fasta	Q96P20	1036	ASC-inflammasome- caspase-1-IL-1/IL-18	NA	28374903	2017	Pubchem_assay
PRRID_2309	Long ds RNA Click for more detail	EMCV, poliovirus and coxasackie virus; Rotavirus, dengue virus, WNV, murine hepatitis virus(virus)	NA	NA	Pattern-associated molecular patterns (PAMPs)	Natural	filament formation mediated receptor tetramerization	MDA5	Rig-like receptor (RLR)	Human	Cytoplasm, all mammalian cell types	NA	Q53TB6.fasta	Q53TB6	435	MAVS-TRAF3-TBK1/ IKKe-IRF3. MAVS-FADD/ TRAF6-IKKs-NF-jB	NA	28374903	2017	Pubchem_assay
PRRID_2309	Long ds RNA Click for more detail	EMCV, poliovirus and coxasackie virus; Rotavirus, dengue virus, WNV, murine hepatitis virus(virus)	NA	NA	Pattern-associated molecular patterns (PAMPs)	Natural	filament formation mediated receptor tetramerization	MDA5	Rig-like receptor (RLR)	Human	Cytoplasm, all mammalian cell types	NA	Q53TB6.fasta	Q53TB6	435	MAVS-TRAF3-TBK1/ IKKe-IRF3. MAVS-FADD/ TRAF6-IKKs-NF-jB	NA	28374903	2017	Pubchem_assay
PRRID_2311	Loxoribine (7-allyl-7,8-dihydro-8-oxo-guanosine) Click for more detail	SeV, flu virus, coxsackie virus, vaccinia virus, MV, RSV, retrovirus (virus)	C=CCN1C2=C(NC(=NC2=O)N)N(C1=O)C3C(C(C(O3)CO)O)O	NA	Pattern-associated molecular patterns (PAMPs)	Natural	Z-loop proteolytic cleavage, and receptor dimer conformational change	Toll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Human	Endosomes. pDCs and B cells	Leucine-rich Repeat (LRR) Domain	Q9NYK1.fasta	Q9NYK1	1049	MyD88-IRAK4/ IRAK1-IRF7. MyD88-IRAF6- IKKs-NF-jB	NA	28374903	2017	Pubchem_assay
PRRID_2311	Loxoribine (7-allyl-7,8-dihydro-8-oxo-guanosine) Click for more detail	SeV, flu virus, coxsackie virus, vaccinia virus, MV, RSV, retrovirus (virus)	C=CCN1C2=C(NC(=NC2=O)N)N(C1=O)C3C(C(C(O3)CO)O)O	NA	Pattern-associated molecular patterns (PAMPs)	Natural	Z-loop proteolytic cleavage, and receptor dimer conformational change	Toll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Human	Endosomes. pDCs and B cells	Leucine-rich Repeat (LRR) Domain	Q9NYK1.fasta	Q9NYK1	1049	MyD88-IRAK4/ IRAK1-IRF7. MyD88-IRAF6- IKKs-NF-jB	NA	28374903	2017	Pubchem_assay
PRRID_2404	NA Click for more detail	Respiratory syncytial virus (virus)	NA	NA	NA	NA	severe RSV bronchiolitis	rs2107538*CCL5	C-C motif chemokine ligand 5	Human	NA	NA	NA	NA	NA	NA	NA	29253610	2017	NA
PRRID_2404	NA Click for more detail	Respiratory syncytial virus (virus)	NA	NA	NA	NA	severe RSV bronchiolitis	rs2107538*CCL5	C-C motif chemokine ligand 5	Human	NA	NA	NA	NA	NA	NA	NA	29253610	2017	NA
PRRID_2405	NA Click for more detail	rhinovirus (virus)	NA	NA	NA	NA	severe RSV bronchiolitis	rs1060826*NOS2	NA	Human	NA	NA	NA	NA	NA	NA	NA	29253610	2017	NA
PRRID_2405	NA Click for more detail	rhinovirus (virus)	NA	NA	NA	NA	severe RSV bronchiolitis	rs1060826*NOS2	NA	Human	NA	NA	NA	NA	NA	NA	NA	29253610	2017	NA
PRRID_2406	NA Click for more detail	Respiratory syncytial virus (virus)	NA	NA	NA	NA	severe RSV bronchiolitis	rs4986790*Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Human	NA	Leucine-rich Repeat (LRR) Domain	NA	NA	NA	NA	NA	29253610	2017	NA
PRRID_2406	NA Click for more detail	Respiratory syncytial virus (virus)	NA	NA	NA	NA	severe RSV bronchiolitis	rs4986790*Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Human	NA	Leucine-rich Repeat (LRR) Domain	NA	NA	NA	NA	NA	29253610	2017	NA
PRRID_2407	NA Click for more detail	Respiratory syncytial virus (virus)	NA	NA	NA	NA	inhibit the production of interferon-in human plasmacytoid dendritic cells	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	NA	Leucine-rich Repeat (LRR) Domain	O60603.fasta	O60603	784	NA	NA	29253610	2017	Pubchem_assay
PRRID_2407	NA Click for more detail	Respiratory syncytial virus (virus)	NA	NA	NA	NA	inhibit the production of interferon-in human plasmacytoid dendritic cells	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	NA	Leucine-rich Repeat (LRR) Domain	O60603.fasta	O60603	784	NA	NA	29253610	2017	Pubchem_assay

previous 1 234 5 6 7 next