Browse result page of PRRDB 2.0

PRRID	Name of Ligand	Source of ligand	Sequence of Ligand	Length of Ligand	Type of Ligand	Occurence	Role of Ligand	Name of Receptor	Type of Reeptor	Source of the Receptor	Localization	Domain	Sequence of Receptor	Swiss prot ID	Length of receptor	Function of Receptor	Assay used	PMID	Year of publication	Pubchem assay
PRRID_2199	Hyaluronan Click for more detail	NA	CC(=O)NC1CC(C(OC1OC2C(C(C(OC2C(=O)[O-])O)O)O)CO)O	NA	Damage-associated molecular patterns (DAMPs)	Natural	Induce the production of TNF-Œ±, IL-1Œ≤ and IL-12 by dendritic cells	Nod-like receptor P3 (NLRP3)	NOD-like receptor (NLR)	Human	dendritic cells	NA	Q96P20.fasta	Q96P20	1036	NA	NA	28961019	2017	Pubchem_assay
PRRID_2199	Hyaluronan Click for more detail	NA	CC(=O)NC1CC(C(OC1OC2C(C(C(OC2C(=O)[O-])O)O)O)CO)O	NA	Damage-associated molecular patterns (DAMPs)	Natural	Induce the production of TNF-Œ±, IL-1Œ≤ and IL-12 by dendritic cells	Nod-like receptor P3 (NLRP3)	NOD-like receptor (NLR)	Human	dendritic cells	NA	Q96P20.fasta	Q96P20	1036	NA	NA	28961019	2017	Pubchem_assay
PRRID_2200	Hyaluronan Click for more detail	NA	CC(=O)NC1CC(C(OC1OC2C(C(C(OC2C(=O)[O-])O)O)O)CO)O	NA	Damage-associated molecular patterns (DAMPs)	Natural	Induce the production of TNF-Œ±, IL-1Œ≤ and IL-12 by dendritic cells	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Human	dendritic cells	NA	O00206.fasta	O00206	839	NA	NA	28961019	2017	Pubchem_assay
PRRID_2200	Hyaluronan Click for more detail	NA	CC(=O)NC1CC(C(OC1OC2C(C(C(OC2C(=O)[O-])O)O)O)CO)O	NA	Damage-associated molecular patterns (DAMPs)	Natural	Induce the production of TNF-Œ±, IL-1Œ≤ and IL-12 by dendritic cells	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Human	dendritic cells	NA	O00206.fasta	O00206	839	NA	NA	28961019	2017	Pubchem_assay
PRRID_2201	Hyaluronic acid Click for more detail	NA	CC(=O)NC1CC(C(OC1OC2C(C(C(OC2C(=O)[O-])O)O)O)CO)O	NA	Damage-associated molecular patterns (DAMPs)	Natural	Induce the maturation of mouse and human dendritic cells,	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	Endothelial cells	NA	O60603.fasta	O60603	784	NA	NA	28961019	2017	Pubchem_assay
PRRID_2201	Hyaluronic acid Click for more detail	NA	CC(=O)NC1CC(C(OC1OC2C(C(C(OC2C(=O)[O-])O)O)O)CO)O	NA	Damage-associated molecular patterns (DAMPs)	Natural	Induce the maturation of mouse and human dendritic cells,	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	Endothelial cells	NA	O60603.fasta	O60603	784	NA	NA	28961019	2017	Pubchem_assay
PRRID_2202	Hyaluronic acid Click for more detail	NA	CC(=O)NC1CC(C(OC1OC2C(C(C(OC2C(=O)[O-])O)O)O)CO)O	NA	Damage-associated molecular patterns (DAMPs)	Natural	Induce the maturation of mouse and human dendritic cells,	Nod-like receptor P3 (NLRP3)	NOD-like receptor (NLR)	Human	Endothelial cells	NA	Q96P20.fasta	Q96P20	1036	NA	NA	28961019	2017	Pubchem_assay
PRRID_2202	Hyaluronic acid Click for more detail	NA	CC(=O)NC1CC(C(OC1OC2C(C(C(OC2C(=O)[O-])O)O)O)CO)O	NA	Damage-associated molecular patterns (DAMPs)	Natural	Induce the maturation of mouse and human dendritic cells,	Nod-like receptor P3 (NLRP3)	NOD-like receptor (NLR)	Human	Endothelial cells	NA	Q96P20.fasta	Q96P20	1036	NA	NA	28961019	2017	Pubchem_assay
PRRID_2203	Hyaluronic acid Click for more detail	NA	CC(=O)NC1CC(C(OC1OC2C(C(C(OC2C(=O)[O-])O)O)O)CO)O	NA	Damage-associated molecular patterns (DAMPs)	Natural	Induce the maturation of mouse and human dendritic cells,	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Human	Endothelial cells	NA	O00206.fasta	O00206	839	NA	NA	28961019	2017	Pubchem_assay
PRRID_2203	Hyaluronic acid Click for more detail	NA	CC(=O)NC1CC(C(OC1OC2C(C(C(OC2C(=O)[O-])O)O)O)CO)O	NA	Damage-associated molecular patterns (DAMPs)	Natural	Induce the maturation of mouse and human dendritic cells,	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Human	Endothelial cells	NA	O00206.fasta	O00206	839	NA	NA	28961019	2017	Pubchem_assay
PRRID_2204	Hyaluronic acid Click for more detail	NA	CC(=O)NC1CC(C(OC1OC2C(C(C(OC2C(=O)[O-])O)O)O)CO)O	NA	Damage-associated molecular patterns (DAMPs)	Natural	Induce the production of TNF-Œ±, IL-1Œ≤ and IL-12 by dendritic cells	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice (Murine)	Macrophages	NA	Q9QUN7.fasta	Q9QUN7	784	NA	NA	28961019	2017	Pubchem_assay
PRRID_2204	Hyaluronic acid Click for more detail	NA	CC(=O)NC1CC(C(OC1OC2C(C(C(OC2C(=O)[O-])O)O)O)CO)O	NA	Damage-associated molecular patterns (DAMPs)	Natural	Induce the production of TNF-Œ±, IL-1Œ≤ and IL-12 by dendritic cells	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice (Murine)	Macrophages	NA	Q9QUN7.fasta	Q9QUN7	784	NA	NA	28961019	2017	Pubchem_assay
PRRID_2205	Hyaluronic acid Click for more detail	NA	CC(=O)NC1CC(C(OC1OC2C(C(C(OC2C(=O)[O-])O)O)O)CO)O	NA	Damage-associated molecular patterns (DAMPs)	Natural	Induce the production of TNF-Œ±, IL-1Œ≤ and IL-12 by dendritic cells	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	Endothelial cells	NA	O60603.fasta	O60603	784	NA	NA	28961019	2017	Pubchem_assay
PRRID_2205	Hyaluronic acid Click for more detail	NA	CC(=O)NC1CC(C(OC1OC2C(C(C(OC2C(=O)[O-])O)O)O)CO)O	NA	Damage-associated molecular patterns (DAMPs)	Natural	Induce the production of TNF-Œ±, IL-1Œ≤ and IL-12 by dendritic cells	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	Endothelial cells	NA	O60603.fasta	O60603	784	NA	NA	28961019	2017	Pubchem_assay
PRRID_2206	Hyaluronic acid Click for more detail	NA	CC(=O)NC1CC(C(OC1OC2C(C(C(OC2C(=O)[O-])O)O)O)CO)O	NA	Damage-associated molecular patterns (DAMPs)	Natural	Induce the production of TNF-Œ±, IL-1Œ≤ and IL-12 by dendritic cells	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Human	Endothelial cells	NA	O00206.fasta	O00206	839	NA	NA	28961019	2017	Pubchem_assay
PRRID_2206	Hyaluronic acid Click for more detail	NA	CC(=O)NC1CC(C(OC1OC2C(C(C(OC2C(=O)[O-])O)O)O)CO)O	NA	Damage-associated molecular patterns (DAMPs)	Natural	Induce the production of TNF-Œ±, IL-1Œ≤ and IL-12 by dendritic cells	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Human	Endothelial cells	NA	O00206.fasta	O00206	839	NA	NA	28961019	2017	Pubchem_assay
PRRID_2207	Hyaluronic acid Click for more detail	NA	CC(=O)NC1CC(C(OC1OC2C(C(C(OC2C(=O)[O-])O)O)O)CO)O	NA	Damage-associated molecular patterns (DAMPs)	Natural	Induce the production of TNF-Œ±, IL-1Œ≤ and IL-12 by dendritic cells	Nod-like receptor P3 (NLRP3)	NOD-like receptor (NLR)	Human	Endothelial cells	NA	Q96P20.fasta	Q96P20	1036	NA	NA	28961019	2017	Pubchem_assay
PRRID_2207	Hyaluronic acid Click for more detail	NA	CC(=O)NC1CC(C(OC1OC2C(C(C(OC2C(=O)[O-])O)O)O)CO)O	NA	Damage-associated molecular patterns (DAMPs)	Natural	Induce the production of TNF-Œ±, IL-1Œ≤ and IL-12 by dendritic cells	Nod-like receptor P3 (NLRP3)	NOD-like receptor (NLR)	Human	Endothelial cells	NA	Q96P20.fasta	Q96P20	1036	NA	NA	28961019	2017	Pubchem_assay
PRRID_2305	LMW-HA Click for more detail	Glycosaminoglycan (others)	NA	NA	Damage-associated molecular patterns (DAMPs)	Natural	involved in the resolution and fine-tuning of inflammation by orchestrating the production of anti-inflammatory mediators that are required for the resolution of tissue inflammation and the transition to acquired immunity	cluster of differentiation 44 (CD44)	Pattern recognition receptor (PRR)	NA	NA	NA	NA	NA	NA	NA	NA	29290139	2017	NA
PRRID_2305	LMW-HA Click for more detail	Glycosaminoglycan (others)	NA	NA	Damage-associated molecular patterns (DAMPs)	Natural	involved in the resolution and fine-tuning of inflammation by orchestrating the production of anti-inflammatory mediators that are required for the resolution of tissue inflammation and the transition to acquired immunity	cluster of differentiation 44 (CD44)	Pattern recognition receptor (PRR)	NA	NA	NA	NA	NA	NA	NA	NA	29290139	2017	NA
PRRID_2306	LMW-HA Click for more detail	Glycosaminoglycan (others)	NA	NA	Damage-associated molecular patterns (DAMPs)	Natural	involved in the resolution and fine-tuning of inflammation by orchestrating the production of anti-inflammatory mediators that are required for the resolution of tissue inflammation and the transition to acquired immunity	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	NA	NA	NA	NA	NA	NA	NA	NA	29290139	2017	NA
PRRID_2306	LMW-HA Click for more detail	Glycosaminoglycan (others)	NA	NA	Damage-associated molecular patterns (DAMPs)	Natural	involved in the resolution and fine-tuning of inflammation by orchestrating the production of anti-inflammatory mediators that are required for the resolution of tissue inflammation and the transition to acquired immunity	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	NA	NA	NA	NA	NA	NA	NA	NA	29290139	2017	NA
PRRID_2307	LMW-HA Click for more detail	Glycosaminoglycan (others)	NA	NA	Damage-associated molecular patterns (DAMPs)	Natural	involved in the resolution and fine-tuning of inflammation by orchestrating the production of anti-inflammatory mediators that are required for the resolution of tissue inflammation and the transition to acquired immunity	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	NA	NA	NA	NA	NA	NA	NA	NA	29290139	2017	NA
PRRID_2307	LMW-HA Click for more detail	Glycosaminoglycan (others)	NA	NA	Damage-associated molecular patterns (DAMPs)	Natural	involved in the resolution and fine-tuning of inflammation by orchestrating the production of anti-inflammatory mediators that are required for the resolution of tissue inflammation and the transition to acquired immunity	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	NA	NA	NA	NA	NA	NA	NA	NA	29290139	2017	NA
PRRID_2308	LMW-HA Click for more detail	Glycosaminoglycan (others)	NA	NA	Damage-associated molecular patterns (DAMPs)	Natural	involved in the resolution and fine-tuning of inflammation by orchestrating the production of anti-inflammatory mediators that are required for the resolution of tissue inflammation and the transition to acquired immunity	Nod-like receptor P3 (NLRP3)	NOD-like receptor (NLR)	NA	NA	NA	NA	NA	NA	NA	NA	29290139	2017	NA
PRRID_2308	LMW-HA Click for more detail	Glycosaminoglycan (others)	NA	NA	Damage-associated molecular patterns (DAMPs)	Natural	involved in the resolution and fine-tuning of inflammation by orchestrating the production of anti-inflammatory mediators that are required for the resolution of tissue inflammation and the transition to acquired immunity	Nod-like receptor P3 (NLRP3)	NOD-like receptor (NLR)	NA	NA	NA	NA	NA	NA	NA	NA	29290139	2017	NA
PRRID_2358	Myosin Click for more detail	Cytosol, endosome(others)	NA	NA	Damage-associated molecular patterns (DAMPs)	Natural	involved in the resolution and fine-tuning of inflammation by orchestrating the production of anti-inflammatory mediators that are required for the resolution of tissue inflammation and the transition to acquired immunity	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	NA	NA	Leucine-rich Repeat (LRR) Domain	NA	NA	NA	NA	NA	29290139	2017	NA
PRRID_2358	Myosin Click for more detail	Cytosol, endosome(others)	NA	NA	Damage-associated molecular patterns (DAMPs)	Natural	involved in the resolution and fine-tuning of inflammation by orchestrating the production of anti-inflammatory mediators that are required for the resolution of tissue inflammation and the transition to acquired immunity	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	NA	NA	Leucine-rich Repeat (LRR) Domain	NA	NA	NA	NA	NA	29290139	2017	NA
PRRID_2359	Myosin Click for more detail	Cytosol, endosome(others)	NA	NA	Damage-associated molecular patterns (DAMPs)	Natural	involved in the resolution and fine-tuning of inflammation by orchestrating the production of anti-inflammatory mediators that are required for the resolution of tissue inflammation and the transition to acquired immunity	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	NA	NA	Leucine-rich Repeat (LRR) Domain	NA	NA	NA	NA	NA	29290139	2017	NA
PRRID_2359	Myosin Click for more detail	Cytosol, endosome(others)	NA	NA	Damage-associated molecular patterns (DAMPs)	Natural	involved in the resolution and fine-tuning of inflammation by orchestrating the production of anti-inflammatory mediators that are required for the resolution of tissue inflammation and the transition to acquired immunity	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	NA	NA	Leucine-rich Repeat (LRR) Domain	NA	NA	NA	NA	NA	29290139	2017	NA
PRRID_2360	Myosin Click for more detail	Cytosol, endosome(others)	NA	NA	Damage-associated molecular patterns (DAMPs)	Natural	involved in the resolution and fine-tuning of inflammation by orchestrating the production of anti-inflammatory mediators that are required for the resolution of tissue inflammation and the transition to acquired immunity	RAGE	Receptor for advanced glycation endproducts (RAGE)	NA	NA	Leucine-rich Repeat (LRR) Domain	NA	NA	NA	NA	NA	29290139	2017	NA
PRRID_2360	Myosin Click for more detail	Cytosol, endosome(others)	NA	NA	Damage-associated molecular patterns (DAMPs)	Natural	involved in the resolution and fine-tuning of inflammation by orchestrating the production of anti-inflammatory mediators that are required for the resolution of tissue inflammation and the transition to acquired immunity	RAGE	Receptor for advanced glycation endproducts (RAGE)	NA	NA	Leucine-rich Repeat (LRR) Domain	NA	NA	NA	NA	NA	29290139	2017	NA
PRRID_2443	NA Click for more detail	E. coli(Bacteria)	MKIKTGARILALSALTTMMFSASALAKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTRITK	396	Damage-associated molecular patterns (DAMPs)	Natural	elicit innate immune response	CTLMA2	C type Lectin (CTL/CLR)	Anopheles gambiae	NA	NA	B2FX57.fasta	B2FX57	165	NA	NA	29051762	2017	Pubchem_assay
PRRID_2443	NA Click for more detail	E. coli(Bacteria)	MKIKTGARILALSALTTMMFSASALAKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTRITK	396	Damage-associated molecular patterns (DAMPs)	Natural	elicit innate immune response	CTLMA2	C type Lectin (CTL/CLR)	Anopheles gambiae	NA	NA	B2FX57.fasta	B2FX57	165	NA	NA	29051762	2017	Pubchem_assay
PRRID_2444	NA Click for more detail	E. caproni(others)	NA	NA	Damage-associated molecular patterns (DAMPs)	Natural	NA	hemoglobin-2	non-canonical proteins interacting with pathogens (NCIP),	NA	NA	NA	NA	NA	NA	NA	NA	29051762	2017	NA
PRRID_2444	NA Click for more detail	E. caproni(others)	NA	NA	Damage-associated molecular patterns (DAMPs)	Natural	NA	hemoglobin-2	non-canonical proteins interacting with pathogens (NCIP),	NA	NA	NA	NA	NA	NA	NA	NA	29051762	2017	NA
PRRID_2592	RNA Click for more detail	All vertebrates(others)	NA	NA	Damage-associated molecular patterns (DAMPs)	Natural	Cellular injury and necrosis	Toll-like receptor 3 (TLR3)	Toll-like receptor (TLR)	Human	NA	Leucine-rich Repeat (LRR) Domain	O15455.fasta	O15455	904	Activate NF-KB	NA	28049142	2017	Pubchem_assay
PRRID_2592	RNA Click for more detail	All vertebrates(others)	NA	NA	Damage-associated molecular patterns (DAMPs)	Natural	Cellular injury and necrosis	Toll-like receptor 3 (TLR3)	Toll-like receptor (TLR)	Human	NA	Leucine-rich Repeat (LRR) Domain	O15455.fasta	O15455	904	Activate NF-KB	NA	28049142	2017	Pubchem_assay
PRRID_2595	ROS Click for more detail	NA	NA	NA	Damage-associated molecular patterns (DAMPs)	Natural	NA	Nod-like receptor P3 (NLRP3)	NOD-like receptor (NLR)	Mice	Microglia	NA	Q8R4B8.fasta	Q8R4B8	1033	NLRP3 inflammasome activation in AD models	NA	28805121	2017	Pubchem_assay
PRRID_2595	ROS Click for more detail	NA	NA	NA	Damage-associated molecular patterns (DAMPs)	Natural	NA	Nod-like receptor P3 (NLRP3)	NOD-like receptor (NLR)	Mice	Microglia	NA	Q8R4B8.fasta	Q8R4B8	1033	NLRP3 inflammasome activation in AD models	NA	28805121	2017	Pubchem_assay
PRRID_2596	ROS Click for more detail	NA	NA	NA	Damage-associated molecular patterns (DAMPs)	Natural	NA	Nod-like receptor P3 (NLRP3)	NOD-like receptor (NLR)	Mice	cortical neurons (cell culture, stroke model)	NA	Q8R4B8.fasta	Q8R4B8	1033	protein ‚Üë in ischemia/reperfusion, role in neuronal cell death and behavioral deficits	NA	28801521	2017	Pubchem_assay
PRRID_2596	ROS Click for more detail	NA	NA	NA	Damage-associated molecular patterns (DAMPs)	Natural	NA	Nod-like receptor P3 (NLRP3)	NOD-like receptor (NLR)	Mice	cortical neurons (cell culture, stroke model)	NA	Q8R4B8.fasta	Q8R4B8	1033	protein ‚Üë in ischemia/reperfusion, role in neuronal cell death and behavioral deficits	NA	28801521	2017	Pubchem_assay
PRRID_2597	ROS Click for more detail	NA	NA	NA	Damage-associated molecular patterns (DAMPs)	Natural	NA	Nod-like receptor P3 (NLRP3)	NOD-like receptor (NLR)	Human	Brain	NA	Q96P20.fasta	Q96P20	1036	protein ‚Üë in ischemia/reperfusion, role in neuronal cell death and behavioral deficits	NA	28801521	2017	Pubchem_assay
PRRID_2597	ROS Click for more detail	NA	NA	NA	Damage-associated molecular patterns (DAMPs)	Natural	NA	Nod-like receptor P3 (NLRP3)	NOD-like receptor (NLR)	Human	Brain	NA	Q96P20.fasta	Q96P20	1036	protein ‚Üë in ischemia/reperfusion, role in neuronal cell death and behavioral deficits	NA	28801521	2017	Pubchem_assay
PRRID_2598	ROS Click for more detail	NA	NA	NA	Damage-associated molecular patterns (DAMPs)	Natural	NA	Nod-like receptor P3 (NLRP3)	NOD-like receptor (NLR)	Rat	primary astrocytes	NA	D4A523.fasta	D4A523	1035	protein ‚Üë, activation of NLRP3 inflammasome in PD models	NA	28801521	2017	Pubchem_assay
PRRID_2598	ROS Click for more detail	NA	NA	NA	Damage-associated molecular patterns (DAMPs)	Natural	NA	Nod-like receptor P3 (NLRP3)	NOD-like receptor (NLR)	Rat	primary astrocytes	NA	D4A523.fasta	D4A523	1035	protein ‚Üë, activation of NLRP3 inflammasome in PD models	NA	28801521	2017	Pubchem_assay
PRRID_2599	ROS Click for more detail	NA	NA	NA	Damage-associated molecular patterns (DAMPs)	Natural	NA	Nod-like receptor P3 (NLRP3)	NOD-like receptor (NLR)	Mice	substantia nigra	NA	Q8R4B8.fasta	Q8R4B8	1033	protein ‚Üë, activation of NLRP3 inflammasome in PD models	NA	28801521	2017	Pubchem_assay
PRRID_2599	ROS Click for more detail	NA	NA	NA	Damage-associated molecular patterns (DAMPs)	Natural	NA	Nod-like receptor P3 (NLRP3)	NOD-like receptor (NLR)	Mice	substantia nigra	NA	Q8R4B8.fasta	Q8R4B8	1033	protein ‚Üë, activation of NLRP3 inflammasome in PD models	NA	28801521	2017	Pubchem_assay
PRRID_2600	ATP Click for more detail	NA	C1=NC2=C(C(=N1)N)N=CN2C3C(C(C(O3)COP(=O)(O)OP(=O)(O)OP(=O)(O)O)O)O	NA	Damage-associated molecular patterns (DAMPs)	Natural	NA	Nod-like receptor P3 (NLRP3)	NOD-like receptor (NLR)	Mice	Microglia	NA	Q8R4B8.fasta	Q8R4B8	1033	NLRP3 inflammasome activation in AD models	NA	28801521	2017	Pubchem_assay
PRRID_2600	ATP Click for more detail	NA	C1=NC2=C(C(=N1)N)N=CN2C3C(C(C(O3)COP(=O)(O)OP(=O)(O)OP(=O)(O)O)O)O	NA	Damage-associated molecular patterns (DAMPs)	Natural	NA	Nod-like receptor P3 (NLRP3)	NOD-like receptor (NLR)	Mice	Microglia	NA	Q8R4B8.fasta	Q8R4B8	1033	NLRP3 inflammasome activation in AD models	NA	28801521	2017	Pubchem_assay
PRRID_2601	S100 proteins Click for more detail	Cytosol(others)	MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE	92	Damage-associated molecular patterns (DAMPs)	Natural	involved in the resolution and fine-tuning of inflammation by orchestrating the production of anti-inflammatory mediators that are required for the resolution of tissue inflammation and the transition to acquired immunity	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	NA	NA	extracellular domain formed by three immunoglobulin domains (V-C1-C2), a single transmembrane domain and cytosolic portions.	NA	NA	NA	NA	NA	29290139	2017	NA
PRRID_2601	S100 proteins Click for more detail	Cytosol(others)	MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE	92	Damage-associated molecular patterns (DAMPs)	Natural	involved in the resolution and fine-tuning of inflammation by orchestrating the production of anti-inflammatory mediators that are required for the resolution of tissue inflammation and the transition to acquired immunity	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	NA	NA	extracellular domain formed by three immunoglobulin domains (V-C1-C2), a single transmembrane domain and cytosolic portions.	NA	NA	NA	NA	NA	29290139	2017	NA
PRRID_2602	S100 proteins Click for more detail	Cytosol(others)	MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE	92	Damage-associated molecular patterns (DAMPs)	Natural	involved in the resolution and fine-tuning of inflammation by orchestrating the production of anti-inflammatory mediators that are required for the resolution of tissue inflammation and the transition to acquired immunity	RAGE	Receptor for advanced glycation endproducts (RAGE)	NA	NA	extracellular domain formed by three immunoglobulin domains (V-C1-C2), a single transmembrane domain and cytosolic portions.	NA	NA	NA	NA	NA	29290139	2017	NA
PRRID_2602	S100 proteins Click for more detail	Cytosol(others)	MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE	92	Damage-associated molecular patterns (DAMPs)	Natural	involved in the resolution and fine-tuning of inflammation by orchestrating the production of anti-inflammatory mediators that are required for the resolution of tissue inflammation and the transition to acquired immunity	RAGE	Receptor for advanced glycation endproducts (RAGE)	NA	NA	extracellular domain formed by three immunoglobulin domains (V-C1-C2), a single transmembrane domain and cytosolic portions.	NA	NA	NA	NA	NA	29290139	2017	NA
PRRID_2603	S100 proteins Click for more detail	NA	MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE	92	Damage-associated molecular patterns (DAMPs)	Natural	acts as stimulator of cell pro- liferation and migration and inhibitor of apoptosis and differ- entiation,	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	NA	Leucine-rich Repeat (LRR) Domain	O60603.fasta	O60603	784	Activate NF-KB	NA	28049142	2017	Pubchem_assay
PRRID_2603	S100 proteins Click for more detail	NA	MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE	92	Damage-associated molecular patterns (DAMPs)	Natural	acts as stimulator of cell pro- liferation and migration and inhibitor of apoptosis and differ- entiation,	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	NA	Leucine-rich Repeat (LRR) Domain	O60603.fasta	O60603	784	Activate NF-KB	NA	28049142	2017	Pubchem_assay
PRRID_2604	S100 proteins Click for more detail	NA	MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE	92	Damage-associated molecular patterns (DAMPs)	Natural	acts as stimulator of cell pro- liferation and migration and inhibitor of apoptosis and differ- entiation,	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Human	NA	Leucine-rich Repeat (LRR) Domain	O00206.fasta	O00206	839	Activate NF-KB	NA	28049142	2017	Pubchem_assay
PRRID_2604	S100 proteins Click for more detail	NA	MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE	92	Damage-associated molecular patterns (DAMPs)	Natural	acts as stimulator of cell pro- liferation and migration and inhibitor of apoptosis and differ- entiation,	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Human	NA	Leucine-rich Repeat (LRR) Domain	O00206.fasta	O00206	839	Activate NF-KB	NA	28049142	2017	Pubchem_assay
PRRID_2605	S100 proteins Click for more detail	NA	MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE	92	Damage-associated molecular patterns (DAMPs)	Natural	acts as stimulator of cell pro- liferation and migration and inhibitor of apoptosis and differ- entiation,	RAGE	Receptor for advanced glycation endproducts (RAGE)	Human	NA	NA	Q15109.fasta	Q15109	404	Activate NF-KB	NA	28049142	2017	Pubchem_assay
PRRID_2605	S100 proteins Click for more detail	NA	MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE	92	Damage-associated molecular patterns (DAMPs)	Natural	acts as stimulator of cell pro- liferation and migration and inhibitor of apoptosis and differ- entiation,	RAGE	Receptor for advanced glycation endproducts (RAGE)	Human	NA	NA	Q15109.fasta	Q15109	404	Activate NF-KB	NA	28049142	2017	Pubchem_assay
PRRID_2606	S100 proteins Click for more detail	NA	MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE	92	Damage-associated molecular patterns (DAMPs)	Natural	Promote human neutrophil migration	RAGE	Receptor for advanced glycation endproducts (RAGE)	Human	Neutrophils	NA	Q15109.fasta	Q15109	404	NA	NA	28961019	2017	Pubchem_assay
PRRID_2606	S100 proteins Click for more detail	NA	MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE	92	Damage-associated molecular patterns (DAMPs)	Natural	Promote human neutrophil migration	RAGE	Receptor for advanced glycation endproducts (RAGE)	Human	Neutrophils	NA	Q15109.fasta	Q15109	404	NA	NA	28961019	2017	Pubchem_assay
PRRID_2607	S100 proteins Click for more detail	NA	MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE	92	Damage-associated molecular patterns (DAMPs)	Natural	Promote human neutrophil migration	RAGE	Receptor for advanced glycation endproducts (RAGE)	Human	Neutrophils	NA	Q15109.fasta	Q15109	404	NA	NA	28961019	2017	Pubchem_assay
PRRID_2607	S100 proteins Click for more detail	NA	MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE	92	Damage-associated molecular patterns (DAMPs)	Natural	Promote human neutrophil migration	RAGE	Receptor for advanced glycation endproducts (RAGE)	Human	Neutrophils	NA	Q15109.fasta	Q15109	404	NA	NA	28961019	2017	Pubchem_assay
PRRID_2608	S100 proteins Click for more detail	NA	MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE	92	Damage-associated molecular patterns (DAMPs)	Natural	Induce the production of TNF-Œ±, IL-1Œ≤, and IL-12 by human monocytes	RAGE	Receptor for advanced glycation endproducts (RAGE)	Human	Monocyte	NA	Q15109.fasta	Q15109	404	NA	NA	28961019	2017	Pubchem_assay
PRRID_2608	S100 proteins Click for more detail	NA	MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE	92	Damage-associated molecular patterns (DAMPs)	Natural	Induce the production of TNF-Œ±, IL-1Œ≤, and IL-12 by human monocytes	RAGE	Receptor for advanced glycation endproducts (RAGE)	Human	Monocyte	NA	Q15109.fasta	Q15109	404	NA	NA	28961019	2017	Pubchem_assay
PRRID_2609	S100 proteins Click for more detail	NA	MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE	92	Damage-associated molecular patterns (DAMPs)	Natural	Induce the production of TNF-Œ±, IL-1Œ≤, and IL-12 by human monocytes	RAGE	Receptor for advanced glycation endproducts (RAGE)	Human	Monocyte	NA	Q15109.fasta	Q15109	404	NA	NA	28961019	2017	Pubchem_assay
PRRID_2609	S100 proteins Click for more detail	NA	MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE	92	Damage-associated molecular patterns (DAMPs)	Natural	Induce the production of TNF-Œ±, IL-1Œ≤, and IL-12 by human monocytes	RAGE	Receptor for advanced glycation endproducts (RAGE)	Human	Monocyte	NA	Q15109.fasta	Q15109	404	NA	NA	28961019	2017	Pubchem_assay
PRRID_2610	S100 proteins Click for more detail	NA	MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE	92	Damage-associated molecular patterns (DAMPs)	Natural	Induce the expression levels of the adhesion	RAGE	Receptor for advanced glycation endproducts (RAGE)	Human	Neutrophils and HUVECs	NA	Q15109.fasta	Q15109	404	NA	NA	28961019	2017	Pubchem_assay
PRRID_2610	S100 proteins Click for more detail	NA	MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE	92	Damage-associated molecular patterns (DAMPs)	Natural	Induce the expression levels of the adhesion	RAGE	Receptor for advanced glycation endproducts (RAGE)	Human	Neutrophils and HUVECs	NA	Q15109.fasta	Q15109	404	NA	NA	28961019	2017	Pubchem_assay
PRRID_2611	S100 proteins Click for more detail	NA	MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE	92	Damage-associated molecular patterns (DAMPs)	Natural	Induce the expression levels of the adhesion	RAGE	Receptor for advanced glycation endproducts (RAGE)	Human	Neutrophils and HUVECs	NA	Q15109.fasta	Q15109	404	NA	NA	28961019	2017	Pubchem_assay
PRRID_2611	S100 proteins Click for more detail	NA	MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE	92	Damage-associated molecular patterns (DAMPs)	Natural	Induce the expression levels of the adhesion	RAGE	Receptor for advanced glycation endproducts (RAGE)	Human	Neutrophils and HUVECs	NA	Q15109.fasta	Q15109	404	NA	NA	28961019	2017	Pubchem_assay
PRRID_2649	Tenascin C Click for more detail	ECM glycoprotein(others)	MGAMTQLLAGVFLAFLALATEGGVLKKVIRHKRQSGVNATLPEENQPVVFNHVYNIKLPVGSQCSVDLESASGEKDLAPPSEPSESFQEHTVDGENQIVFTHRINIPRRACGCAAAPDVKELLSRLEELENLVSSLREQCTAGAGCCLQPATGRLDTRPFCSGRGNFSTEGCGCVCEPGWKGPNCSEPECPGNCHLRGRCIDGQCICDDGFTGEDCSQLACPSDCNDQGKCVNGVCICFEGYAGADCSREICPVPCSEEHGTCVDGLCVCHDGFAGDDCNKPLCLNNCYNRGRCVENECVCDEGFTGEDCSELICPNDCFDRGRCINGTCYCEEGFTGEDCGKPTCPHACHTQGRCEEGQCVCDEGFAGVDCSEKRCPADCHNRGRCVDGRCECDDGFTGADCGELKCPNGCSGHGRCVNGQCVCDEGYTGEDCSQLRCPNDCHSRGRCVEGKCVCEQGFKGYDCSDMSCPNDCHQHGRCVNGMCVCDDGYTGEDCRDRQCPRDCSNRGLCVDGQCVCEDGFTGPDCAELSCPNDCHGQGRCVNGQCVCHEGFMGKDCKEQRCPSDCHGQGRCVDGQCICHEGFTGLDCGQHSCPSDCNNLGQCVSGRCICNEGYSGEDCSEVSPPKDLVVTEVTEETVNLAWDNEMRVTEYLVVYTPTHEGGLEMQFRVPGDQTSTIIQELEPGVEYFIRVFAILENKKSIPVSARVATYLPAPEGLKFKSIKETSVEVEWDPLDIAFETWEIIFRNMNKEDEGEITKSLRRPETSYRQTGLAPGQEYEISLHIVKNNTRGPGLKRVTTTRLDAPSQIEVKDVTDTTALITWFKPLAEIDGIELTYGIKDVPGDRTTIDLTEDENQYSIGNLKPDTEYEVSLISRRGDMSSNPAKETFTTGLDAPRNLRRVSQTDNSITLEWRNGKAAIDSYRIKYAPISGGDHAEVDVPKSQQATTKTTLTGLRPGTEYGIGVSAVKEDKESNPATINAATELDTPKDLQVSETAETS	2201	Damage-associated molecular patterns (DAMPs)	Natural	involved in the resolution and fine-tuning of inflammation by orchestrating the production of anti-inflammatory mediators that are required for the resolution of tissue inflammation and the transition to acquired immunity	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	NA	NA	Leucine-rich Repeat (LRR) Domain	NA	NA	NA	NA	NA	29290139	2017	NA
PRRID_2649	Tenascin C Click for more detail	ECM glycoprotein(others)	MGAMTQLLAGVFLAFLALATEGGVLKKVIRHKRQSGVNATLPEENQPVVFNHVYNIKLPVGSQCSVDLESASGEKDLAPPSEPSESFQEHTVDGENQIVFTHRINIPRRACGCAAAPDVKELLSRLEELENLVSSLREQCTAGAGCCLQPATGRLDTRPFCSGRGNFSTEGCGCVCEPGWKGPNCSEPECPGNCHLRGRCIDGQCICDDGFTGEDCSQLACPSDCNDQGKCVNGVCICFEGYAGADCSREICPVPCSEEHGTCVDGLCVCHDGFAGDDCNKPLCLNNCYNRGRCVENECVCDEGFTGEDCSELICPNDCFDRGRCINGTCYCEEGFTGEDCGKPTCPHACHTQGRCEEGQCVCDEGFAGVDCSEKRCPADCHNRGRCVDGRCECDDGFTGADCGELKCPNGCSGHGRCVNGQCVCDEGYTGEDCSQLRCPNDCHSRGRCVEGKCVCEQGFKGYDCSDMSCPNDCHQHGRCVNGMCVCDDGYTGEDCRDRQCPRDCSNRGLCVDGQCVCEDGFTGPDCAELSCPNDCHGQGRCVNGQCVCHEGFMGKDCKEQRCPSDCHGQGRCVDGQCICHEGFTGLDCGQHSCPSDCNNLGQCVSGRCICNEGYSGEDCSEVSPPKDLVVTEVTEETVNLAWDNEMRVTEYLVVYTPTHEGGLEMQFRVPGDQTSTIIQELEPGVEYFIRVFAILENKKSIPVSARVATYLPAPEGLKFKSIKETSVEVEWDPLDIAFETWEIIFRNMNKEDEGEITKSLRRPETSYRQTGLAPGQEYEISLHIVKNNTRGPGLKRVTTTRLDAPSQIEVKDVTDTTALITWFKPLAEIDGIELTYGIKDVPGDRTTIDLTEDENQYSIGNLKPDTEYEVSLISRRGDMSSNPAKETFTTGLDAPRNLRRVSQTDNSITLEWRNGKAAIDSYRIKYAPISGGDHAEVDVPKSQQATTKTTLTGLRPGTEYGIGVSAVKEDKESNPATINAATELDTPKDLQVSETAETS	2201	Damage-associated molecular patterns (DAMPs)	Natural	involved in the resolution and fine-tuning of inflammation by orchestrating the production of anti-inflammatory mediators that are required for the resolution of tissue inflammation and the transition to acquired immunity	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	NA	NA	Leucine-rich Repeat (LRR) Domain	NA	NA	NA	NA	NA	29290139	2017	NA
PRRID_2670	Uric acid Click for more detail	Cytosol(others)	C12=C(NC(=O)N1)NC(=O)NC2=O	NA	Damage-associated molecular patterns (DAMPs)	Natural	involved in the resolution and fine-tuning of inflammation by orchestrating the production of anti-inflammatory mediators that are required for the resolution of tissue inflammation and the transition to acquired immunity	Nod-like receptor P3 (NLRP3)	NOD-like receptor (NLR)	NA	NA	NA	NA	NA	NA	NA	NA	29290139	2017	NA
PRRID_2670	Uric acid Click for more detail	Cytosol(others)	C12=C(NC(=O)N1)NC(=O)NC2=O	NA	Damage-associated molecular patterns (DAMPs)	Natural	involved in the resolution and fine-tuning of inflammation by orchestrating the production of anti-inflammatory mediators that are required for the resolution of tissue inflammation and the transition to acquired immunity	Nod-like receptor P3 (NLRP3)	NOD-like receptor (NLR)	NA	NA	NA	NA	NA	NA	NA	NA	29290139	2017	NA
PRRID_2671	Uric acid Click for more detail	NA	C12=C(NC(=O)N1)NC(=O)NC2=O	NA	Damage-associated molecular patterns (DAMPs)	Natural	Induce the synthesis of IL-1Œ≤, TNF-Œ± and TGF-Œ≤ by murine macrophages.	Nod-like receptor P3 (NLRP3)	NOD-like receptor (NLR)	Mice	Microglia	NA	Q8R4B8.fasta	Q8R4B8	1033	NLRP3 inflammasome activation in AD models	NA	28805121	2017	Pubchem_assay
PRRID_2671	Uric acid Click for more detail	NA	C12=C(NC(=O)N1)NC(=O)NC2=O	NA	Damage-associated molecular patterns (DAMPs)	Natural	Induce the synthesis of IL-1Œ≤, TNF-Œ± and TGF-Œ≤ by murine macrophages.	Nod-like receptor P3 (NLRP3)	NOD-like receptor (NLR)	Mice	Microglia	NA	Q8R4B8.fasta	Q8R4B8	1033	NLRP3 inflammasome activation in AD models	NA	28805121	2017	Pubchem_assay
PRRID_2672	Uric acid Click for more detail	NA	C12=C(NC(=O)N1)NC(=O)NC2=O	NA	Damage-associated molecular patterns (DAMPs)	Natural	Induce the synthesis of IL-1Œ≤, TNF-Œ± and TGF-Œ≤ by murine macrophages.	Nod-like receptor P3 (NLRP3)	NOD-like receptor (NLR)	Mice	cortical neurons (cell culture, stroke model)	NA	Q8R4B8.fasta	Q8R4B8	1033	protein ‚Üë in ischemia/reperfusion, role in neuronal cell death and behavioral deficits	NA	28801521	2017	Pubchem_assay
PRRID_2672	Uric acid Click for more detail	NA	C12=C(NC(=O)N1)NC(=O)NC2=O	NA	Damage-associated molecular patterns (DAMPs)	Natural	Induce the synthesis of IL-1Œ≤, TNF-Œ± and TGF-Œ≤ by murine macrophages.	Nod-like receptor P3 (NLRP3)	NOD-like receptor (NLR)	Mice	cortical neurons (cell culture, stroke model)	NA	Q8R4B8.fasta	Q8R4B8	1033	protein ‚Üë in ischemia/reperfusion, role in neuronal cell death and behavioral deficits	NA	28801521	2017	Pubchem_assay
PRRID_2673	Uric acid Click for more detail	NA	C12=C(NC(=O)N1)NC(=O)NC2=O	NA	Damage-associated molecular patterns (DAMPs)	Natural	Induce the synthesis of IL-1Œ≤, TNF-Œ± and TGF-Œ≤ by murine macrophages.	Nod-like receptor P3 (NLRP3)	NOD-like receptor (NLR)	Human	Brain	NA	Q96P20.fasta	Q96P20	1036	protein ‚Üë in ischemia/reperfusion, role in neuronal cell death and behavioral deficits	NA	28801521	2017	Pubchem_assay
PRRID_2673	Uric acid Click for more detail	NA	C12=C(NC(=O)N1)NC(=O)NC2=O	NA	Damage-associated molecular patterns (DAMPs)	Natural	Induce the synthesis of IL-1Œ≤, TNF-Œ± and TGF-Œ≤ by murine macrophages.	Nod-like receptor P3 (NLRP3)	NOD-like receptor (NLR)	Human	Brain	NA	Q96P20.fasta	Q96P20	1036	protein ‚Üë in ischemia/reperfusion, role in neuronal cell death and behavioral deficits	NA	28801521	2017	Pubchem_assay
PRRID_2674	Uric acid Click for more detail	NA	C12=C(NC(=O)N1)NC(=O)NC2=O	NA	Damage-associated molecular patterns (DAMPs)	Natural	Induce the synthesis of IL-1Œ≤, TNF-Œ± and TGF-Œ≤ by murine macrophages.	Nod-like receptor P3 (NLRP3)	NOD-like receptor (NLR)	Rat	primary astrocytes	NA	D4A523.fasta	D4A523	1035	protein ‚Üë, activation of NLRP3 inflammasome in PD models	NA	28801521	2017	Pubchem_assay
PRRID_2674	Uric acid Click for more detail	NA	C12=C(NC(=O)N1)NC(=O)NC2=O	NA	Damage-associated molecular patterns (DAMPs)	Natural	Induce the synthesis of IL-1Œ≤, TNF-Œ± and TGF-Œ≤ by murine macrophages.	Nod-like receptor P3 (NLRP3)	NOD-like receptor (NLR)	Rat	primary astrocytes	NA	D4A523.fasta	D4A523	1035	protein ‚Üë, activation of NLRP3 inflammasome in PD models	NA	28801521	2017	Pubchem_assay
PRRID_2675	Uric acid Click for more detail	NA	C12=C(NC(=O)N1)NC(=O)NC2=O	NA	Damage-associated molecular patterns (DAMPs)	Natural	Induce the synthesis of IL-1Œ≤, TNF-Œ± and TGF-Œ≤ by murine macrophages.	Nod-like receptor P3 (NLRP3)	NOD-like receptor (NLR)	Mice	substantia nigra	NA	Q8R4B8.fasta	Q8R4B8	1033	protein ‚Üë, activation of NLRP3 inflammasome in PD models	NA	28801521	2017	Pubchem_assay
PRRID_2675	Uric acid Click for more detail	NA	C12=C(NC(=O)N1)NC(=O)NC2=O	NA	Damage-associated molecular patterns (DAMPs)	Natural	Induce the synthesis of IL-1Œ≤, TNF-Œ± and TGF-Œ≤ by murine macrophages.	Nod-like receptor P3 (NLRP3)	NOD-like receptor (NLR)	Mice	substantia nigra	NA	Q8R4B8.fasta	Q8R4B8	1033	protein ‚Üë, activation of NLRP3 inflammasome in PD models	NA	28801521	2017	Pubchem_assay
PRRID_2676	Uric acid Click for more detail	NA	C12=C(NC(=O)N1)NC(=O)NC2=O	NA	Damage-associated molecular patterns (DAMPs)	Natural	Induce the synthesis of IL-1Œ≤, TNF-Œ± and TGF-Œ≤ by murine macrophages.	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice (Murine)	Macrophages	Leucine-rich Repeat (LRR) Domain	Q9NR97.fasta	Q9QUK7	511	NA	NA	28961019	2017	Pubchem_assay
PRRID_2676	Uric acid Click for more detail	NA	C12=C(NC(=O)N1)NC(=O)NC2=O	NA	Damage-associated molecular patterns (DAMPs)	Natural	Induce the synthesis of IL-1Œ≤, TNF-Œ± and TGF-Œ≤ by murine macrophages.	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice (Murine)	Macrophages	Leucine-rich Repeat (LRR) Domain	Q9NR97.fasta	Q9QUK7	511	NA	NA	28961019	2017	Pubchem_assay
PRRID_2677	Uric acid Click for more detail	NA	C12=C(NC(=O)N1)NC(=O)NC2=O	NA	Damage-associated molecular patterns (DAMPs)	Natural	Induce the synthesis of IL-1Œ≤, TNF-Œ± and TGF-Œ≤ by murine macrophages.	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Mice (Murine)	Macrophages	Leucine-rich Repeat (LRR) Domain	Q9QUN6.fasta	Q9QUK6	835	NA	NA	28961019	2017	Pubchem_assay
PRRID_2677	Uric acid Click for more detail	NA	C12=C(NC(=O)N1)NC(=O)NC2=O	NA	Damage-associated molecular patterns (DAMPs)	Natural	Induce the synthesis of IL-1Œ≤, TNF-Œ± and TGF-Œ≤ by murine macrophages.	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Mice (Murine)	Macrophages	Leucine-rich Repeat (LRR) Domain	Q9QUN6.fasta	Q9QUK6	835	NA	NA	28961019	2017	Pubchem_assay
PRRID_2678	Uric acid Click for more detail	NA	C12=C(NC(=O)N1)NC(=O)NC2=O	NA	Damage-associated molecular patterns (DAMPs)	Natural	Induce the synthesis of IL-1Ôõú, IL-6Ôòæ, IL-8ÔôÄ, TNF-Œ±, TXA2 and PGE2 by human monocytes.	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	Monocyte	Leucine-rich Repeat (LRR) Domain	O60603.fasta	O60603	784	NA	NA	28961019	2017	Pubchem_assay
PRRID_2678	Uric acid Click for more detail	NA	C12=C(NC(=O)N1)NC(=O)NC2=O	NA	Damage-associated molecular patterns (DAMPs)	Natural	Induce the synthesis of IL-1Ôõú, IL-6Ôòæ, IL-8ÔôÄ, TNF-Œ±, TXA2 and PGE2 by human monocytes.	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	Monocyte	Leucine-rich Repeat (LRR) Domain	O60603.fasta	O60603	784	NA	NA	28961019	2017	Pubchem_assay
PRRID_2679	Uric acid Click for more detail	NA	C12=C(NC(=O)N1)NC(=O)NC2=O	NA	Damage-associated molecular patterns (DAMPs)	Natural	Induce the synthesis of IL-1Ôõú, IL-6Ôòæ, IL-8ÔôÄ, TNF-Œ±, TXA2 and PGE2 by human monocytes.	NA	Toll-like receptor (TLR)	Human	Monocyte	Leucine-rich Repeat (LRR) Domain	O00206.fasta	O00206	839	NA	NA	28961019	2017	Pubchem_assay
PRRID_2679	Uric acid Click for more detail	NA	C12=C(NC(=O)N1)NC(=O)NC2=O	NA	Damage-associated molecular patterns (DAMPs)	Natural	Induce the synthesis of IL-1Ôõú, IL-6Ôòæ, IL-8ÔôÄ, TNF-Œ±, TXA2 and PGE2 by human monocytes.	NA	Toll-like receptor (TLR)	Human	Monocyte	Leucine-rich Repeat (LRR) Domain	O00206.fasta	O00206	839	NA	NA	28961019	2017	Pubchem_assay

previous 1 2 3 456 7 8 9 10 next