| Primary information |
|---|
| PRRID | PRRID_2603 |
| Ligand Name | S100 proteins |
| Source | NA |
| Sequence of ligand | MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE |
| Length | 92 |
| Type | Damage-associated molecular patterns (DAMPs) |
| Occurence | Natural |
| Role of Ligand | acts as stimulator of cell pro- liferation and migration and inhibitor of apoptosis and differ- entiation, |
| Name of receptor | Toll-like receptor 2 (TLR2) |
| Type of receptor | Toll-like receptor (TLR) |
| Source | Human |
| Localization | NA |
| Domain | Leucine-rich Repeat (LRR) Domain |
| Sequence of Receptor | O60603.fasta |
| Swiss prot ID | O60603 |
| Length Of Receptor | 784 |
| Function | Activate NF-KB |
| Assay used | NA |
| PMID | 28049142 |
| Year of Publication | 2017 |
| Pubchem assay | Pubchem_assay |
| Primary information |
|---|
| PRRID | PRRID_2603 |
| Ligand Name | S100 proteins |
| Source | NA |
| Sequence of ligand | MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE |
| Length | 92 |
| Type | Damage-associated molecular patterns (DAMPs) |
| Occurence | Natural |
| Role of Ligand | acts as stimulator of cell pro- liferation and migration and inhibitor of apoptosis and differ- entiation, |
| Name of receptor | Toll-like receptor 2 (TLR2) |
| Type of receptor | Toll-like receptor (TLR) |
| Source | Human |
| Localization | NA |
| Domain | Leucine-rich Repeat (LRR) Domain |
| Sequence of Receptor | O60603.fasta |
| Swiss prot ID | O60603 |
| Length Of Receptor | 784 |
| Function | Activate NF-KB |
| Assay used | NA |
| PMID | 28049142 |
| Year of Publication | 2017 |
| Pubchem assay | Pubchem_assay |