Detailed description page of PRRDB2.0
This page displays user query in tabular form. |
PRRID_2607 details |
Primary information | |
---|---|
PRRID | PRRID_2607 |
Ligand Name | S100 proteins |
Source | NA |
Sequence of ligand | MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE |
Length | 92 |
Type | Damage-associated molecular patterns (DAMPs) |
Occurence | Natural |
Role of Ligand | Promote human neutrophil migration |
Name of receptor | RAGE |
Type of receptor | Receptor for advanced glycation endproducts (RAGE) |
Source | Human |
Localization | Neutrophils |
Domain | NA |
Sequence of Receptor | Q15109.fasta |
Swiss prot ID | Q15109 |
Length Of Receptor | 404 |
Function | NA |
Assay used | NA |
PMID | 28961019 |
Year of Publication | 2017 |
Pubchem assay | Pubchem_assay |
Primary information | |
---|---|
PRRID | PRRID_2607 |
Ligand Name | S100 proteins |
Source | NA |
Sequence of ligand | MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE |
Length | 92 |
Type | Damage-associated molecular patterns (DAMPs) |
Occurence | Natural |
Role of Ligand | Promote human neutrophil migration |
Name of receptor | RAGE |
Type of receptor | Receptor for advanced glycation endproducts (RAGE) |
Source | Human |
Localization | Neutrophils |
Domain | NA |
Sequence of Receptor | Q15109.fasta |
Swiss prot ID | Q15109 |
Length Of Receptor | 404 |
Function | NA |
Assay used | NA |
PMID | 28961019 |
Year of Publication | 2017 |
Pubchem assay | Pubchem_assay |