Browse result page of PRRDB 2.0
| PRRID | Name of Ligand | Source of ligand | Sequence of Ligand | Length of Ligand | Type of Ligand | Occurence | Role of Ligand | Name of Receptor | Type of Reeptor | Source of the Receptor | Localization | Domain | Sequence of Receptor | Swiss prot ID | Length of receptor | Function of Receptor | Assay used | PMID | Year of publication | Pubchem assay |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| PRRID_0475 | dsRNA Click for more detail | Virus | NA | NA | Nucleic Acid | Natural | NA | PGRP-S3 | Peptidoglycan Recognition Receptor (PGRPs) | Chlamys farreri | mantle, gill, kidney and gonad | NA | Q9VYX7.fasta | Q9VYX7 | 203 | It has the role in the inflammation. | NA | 20713100 | 2010 | Pubchem Assay |
| PRRID_0475 | dsRNA Click for more detail | Virus | NA | NA | Nucleic Acid | Natural | NA | PGRP-S3 | Peptidoglycan Recognition Receptor (PGRPs) | Chlamys farreri | mantle, gill, kidney and gonad | NA | Q9VYX7.fasta | Q9VYX7 | 203 | It has the role in the inflammation. | NA | 20713100 | 2010 | Pubchem Assay |
| PRRID_0669 | Lys-type PGN Click for more detail | Gram-positive bacteria | CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N | NA | Peptidoglycan | Natural | NA | PGRP-S1 | Peptidoglycan Recognition Receptor (PGRPs) | Chlamys farreri | mantle, gill, kidney and gonad | NA | Q9VYX7.fasta | Q9VYX7 | 203 | It leads to the degradation of PGN, induction of phagocytosis and activation of prophenoloxidase (proPO) system | NA | 20713100 | 2010 | Pubchem Assay |
| PRRID_0669 | Lys-type PGN Click for more detail | Gram-positive bacteria | CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N | NA | Peptidoglycan | Natural | NA | PGRP-S1 | Peptidoglycan Recognition Receptor (PGRPs) | Chlamys farreri | mantle, gill, kidney and gonad | NA | Q9VYX7.fasta | Q9VYX7 | 203 | It leads to the degradation of PGN, induction of phagocytosis and activation of prophenoloxidase (proPO) system | NA | 20713100 | 2010 | Pubchem Assay |
| PRRID_0678 | meso-diaminopimelic Dap-type PGN Click for more detail | Gram-positive bacteria | NA | NA | Peptidoglycan | Natural | NA | PGRP-S1 | Peptidoglycan Recognition Receptor (PGRPs) | Chlamys farreri | mantle, gill, kidney and gonad | NA | Q9VYX7.fasta | Q9VYX7 | 203 | It leads to the degradation of PGN, induction of phagocytosis and activation of prophenoloxidase (proPO) system | NA | 20713100 | 2010 | Pubchem Assay |
| PRRID_0678 | meso-diaminopimelic Dap-type PGN Click for more detail | Gram-positive bacteria | NA | NA | Peptidoglycan | Natural | NA | PGRP-S1 | Peptidoglycan Recognition Receptor (PGRPs) | Chlamys farreri | mantle, gill, kidney and gonad | NA | Q9VYX7.fasta | Q9VYX7 | 203 | It leads to the degradation of PGN, induction of phagocytosis and activation of prophenoloxidase (proPO) system | NA | 20713100 | 2010 | Pubchem Assay |
| PRRID_0743 | Peptidoglycan (PGN) Click for more detail | Vibrio anguillarum and Micrococcus lysodeikticus (Bacteria) | CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N | NA | Peptidoglycan | Natural | NA | PGRP-S1 | Peptidoglycan Recognition Receptor (PGRPs) | Chlamys farreri | mantle, gill, kidney and gonad | NA | Q9VYX7.fasta | Q9VYX7 | 203 | It leads to the degradation of PGN, induction of phagocytosis and activation of prophenoloxidase (proPO) system | ELISA | 20713100 | 2010 | Pubchem Assay |
| PRRID_0743 | Peptidoglycan (PGN) Click for more detail | Vibrio anguillarum and Micrococcus lysodeikticus (Bacteria) | CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N | NA | Peptidoglycan | Natural | NA | PGRP-S1 | Peptidoglycan Recognition Receptor (PGRPs) | Chlamys farreri | mantle, gill, kidney and gonad | NA | Q9VYX7.fasta | Q9VYX7 | 203 | It leads to the degradation of PGN, induction of phagocytosis and activation of prophenoloxidase (proPO) system | ELISA | 20713100 | 2010 | Pubchem Assay |
| PRRID_0744 | Lipopolysaccharide (LPS) Click for more detail | Vibrio anguillarum and Micrococcus lysodeikticus (Bacteria) | CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC | NA | Lipopolysaccharide (LPS) | Natural | NA | PGRP-S1 | Peptidoglycan Recognition Receptor (PGRPs) | Chlamys farreri | mantle, gill, kidney and gonad | NA | Q9VYX7.fasta | Q9VYX7 | 203 | It leads to the degradation of PGN, induction of phagocytosis and activation of prophenoloxidase (proPO) system | ELISA | 20713100 | 2010 | Pubchem Assay |
| PRRID_0744 | Lipopolysaccharide (LPS) Click for more detail | Vibrio anguillarum and Micrococcus lysodeikticus (Bacteria) | CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC | NA | Lipopolysaccharide (LPS) | Natural | NA | PGRP-S1 | Peptidoglycan Recognition Receptor (PGRPs) | Chlamys farreri | mantle, gill, kidney and gonad | NA | Q9VYX7.fasta | Q9VYX7 | 203 | It leads to the degradation of PGN, induction of phagocytosis and activation of prophenoloxidase (proPO) system | ELISA | 20713100 | 2010 | Pubchem Assay |
| PRRID_0852 | β -1,3-glucan Click for more detail | Fungi | C(C1C(C(C(C(O1)OC2C(OC(C(C2O)O)OC3C(OC(C(C3O)O)O)CO)CO)O)O)O)O | NA | Glucan | Natural | NA | PGRP-S2 | Peptidoglycan Recognition Receptor (PGRPs) | Chlamys farreri | mantle, gill, kidney and gonad | NA | Q9VYX7.fasta | Q9VYX7 | 203 | It has the role in the inflammation. | NA | 20713100 | 2010 | Pubchem Assay |
| PRRID_0852 | β -1,3-glucan Click for more detail | Fungi | C(C1C(C(C(C(O1)OC2C(OC(C(C2O)O)OC3C(OC(C(C3O)O)O)CO)CO)O)O)O)O | NA | Glucan | Natural | NA | PGRP-S2 | Peptidoglycan Recognition Receptor (PGRPs) | Chlamys farreri | mantle, gill, kidney and gonad | NA | Q9VYX7.fasta | Q9VYX7 | 203 | It has the role in the inflammation. | NA | 20713100 | 2010 | Pubchem Assay |
| PRRID_1486 | Mgn1703 Click for more detail | NA | NA | NA | novel, synthetic, dumb- bell-shaped, covalently closed Dna molecule | Synthetic | immuno modulators | PGLYRP-2 | Peptidoglycan Recognition Receptor (PGRPs) | Human patients with metastatic colorectal carcinoma (CRC) | plasmacytoid dendritic cells (pDC) and B cells | cell compartment | Q9NR96.fasta | Q9NR96 | 1032 | TLR9 plays a crucial role in breaking tolerance and developing autoimmunity | NA | 24816725 | 2014 | Pubchem_assay |
| PRRID_1486 | Mgn1703 Click for more detail | NA | NA | NA | novel, synthetic, dumb- bell-shaped, covalently closed Dna molecule | Synthetic | immuno modulators | PGLYRP-2 | Peptidoglycan Recognition Receptor (PGRPs) | Human patients with metastatic colorectal carcinoma (CRC) | plasmacytoid dendritic cells (pDC) and B cells | cell compartment | Q9NR96.fasta | Q9NR96 | 1032 | TLR9 plays a crucial role in breaking tolerance and developing autoimmunity | NA | 24816725 | 2014 | Pubchem_assay |
| PRRID_1487 | monomeric flagellin Click for more detail | Bacteria | MAQVINTNSLSLITQNNINKNQSALSSSIERLSSGLRINSAKDDAAGQAIANRFTSNIKGLTQAARNANDGISVAQTTEGALSEINNNLQRVRELTVQATTGTNSESDLSSIQDEIKSRLDEIDRVSGQTQFNGVNVLAKNGSMKIQVGANDNQTITIDLKQIDAKTLGLDGFSVKNNDTVTTSAPVTAFGATTTNNIKLTGITLSTEAATDTGGTNPASIEGVYTDNGNDYYAKITGGDNDGKYYAVTVANDGTVTMATGATANATVTDANTTKATTITSGGTPVQIDNTAGSATANLGAVSLVKLQDSKGNDTDTYALKDTNGNLYAADVNETTGAVSVKTITYTDSSGAASSPTAVKLGGDDGKTEVVDIDGKTYDSADLNGGNLQTGLTAGGEALTAVANGKTTDPLKALDDAIASVDKFRSSLGAVQNRLDSAVTNLNNTTTNLSEAQSRIQDADYATEVSNMSKAQIIQQAGNSVLAKANQVPQQVLSLLQG | 498 | Pattern-associated molecular patterns (PAMPs) | Natural | It directly interac with TLR 5 and induces immune response | PGLYRP-2 | Peptidoglycan Recognition Receptor (PGRPs) | Mice | monocyte/macrophages, DCs | Cell Surface (Exogenous) | Q9JLF7.fasta | Q9JLF7 | 859 | It stimulates the production of proinflammatory cytokines, such as TNF-α, through signaling via the adaptor protein MyD88. | reverse transcription–polymerase chain reaction (RT–PCR), real-time RT–PCR, flow cytometry, immunocytochemistry and Western blot analysis. | 24828022 | 2014 | Pubchem_assay |
| PRRID_1487 | monomeric flagellin Click for more detail | Bacteria | MAQVINTNSLSLITQNNINKNQSALSSSIERLSSGLRINSAKDDAAGQAIANRFTSNIKGLTQAARNANDGISVAQTTEGALSEINNNLQRVRELTVQATTGTNSESDLSSIQDEIKSRLDEIDRVSGQTQFNGVNVLAKNGSMKIQVGANDNQTITIDLKQIDAKTLGLDGFSVKNNDTVTTSAPVTAFGATTTNNIKLTGITLSTEAATDTGGTNPASIEGVYTDNGNDYYAKITGGDNDGKYYAVTVANDGTVTMATGATANATVTDANTTKATTITSGGTPVQIDNTAGSATANLGAVSLVKLQDSKGNDTDTYALKDTNGNLYAADVNETTGAVSVKTITYTDSSGAASSPTAVKLGGDDGKTEVVDIDGKTYDSADLNGGNLQTGLTAGGEALTAVANGKTTDPLKALDDAIASVDKFRSSLGAVQNRLDSAVTNLNNTTTNLSEAQSRIQDADYATEVSNMSKAQIIQQAGNSVLAKANQVPQQVLSLLQG | 498 | Pattern-associated molecular patterns (PAMPs) | Natural | It directly interac with TLR 5 and induces immune response | PGLYRP-2 | Peptidoglycan Recognition Receptor (PGRPs) | Mice | monocyte/macrophages, DCs | Cell Surface (Exogenous) | Q9JLF7.fasta | Q9JLF7 | 859 | It stimulates the production of proinflammatory cytokines, such as TNF-α, through signaling via the adaptor protein MyD88. | reverse transcription–polymerase chain reaction (RT–PCR), real-time RT–PCR, flow cytometry, immunocytochemistry and Western blot analysis. | 24828022 | 2014 | Pubchem_assay |
| PRRID_1495 | muramyl tripeptide Click for more detail | Mycobacteria (Bacteria) | CCCCCCCCCCCCCCCC(=O)OCC(COP(=O)(O)OCCNC(=O)C(C)NC(=O)CCC(C(=O)N)NC(=O)C(C)NC(=O)C(C)OC1C(C(OC(C1O)CO)O)NC(=O)C)OC(=O)CCCCCCCCCCCCCCC | NA | Peptide | Natural | in vitro activates Nod | PGLYRP-2 | Peptidoglycan Recognition Receptor (PGRPs) | Mice | intraepithelial T lymphocytes | intracellular receptors | Q9JLF7.fasta | Q9JLF7 | 859 | recognises peptidoglycan of bacterial cell wall | NA | 24779390 | 2014 | Pubchem_assay |
| PRRID_1495 | muramyl tripeptide Click for more detail | Mycobacteria (Bacteria) | CCCCCCCCCCCCCCCC(=O)OCC(COP(=O)(O)OCCNC(=O)C(C)NC(=O)CCC(C(=O)N)NC(=O)C(C)NC(=O)C(C)OC1C(C(OC(C1O)CO)O)NC(=O)C)OC(=O)CCCCCCCCCCCCCCC | NA | Peptide | Natural | in vitro activates Nod | PGLYRP-2 | Peptidoglycan Recognition Receptor (PGRPs) | Mice | intraepithelial T lymphocytes | intracellular receptors | Q9JLF7.fasta | Q9JLF7 | 859 | recognises peptidoglycan of bacterial cell wall | NA | 24779390 | 2014 | Pubchem_assay |
| PRRID_1496 | muramyl tripeptide Click for more detail | Mycobacteria (Bacteria) | CCCCCCCCCCCCCCCC(=O)OCC(COP(=O)(O)OCCNC(=O)C(C)NC(=O)CCC(C(=O)N)NC(=O)C(C)NC(=O)C(C)OC1C(C(OC(C1O)CO)O)NC(=O)C)OC(=O)CCCCCCCCCCCCCCC | NA | Peptide | Natural | in vitro activates Nod | PGLYRP-2 | Peptidoglycan Recognition Receptor (PGRPs) | Human | intraepithelial T lymphocytes | intracellular receptors | Q96PD5.fasta | Q96PD5 | 576 | recognises peptidoglycan of bacterial cell wall | NA | 24779390 | 2014 | Pubchem_assay |
| PRRID_1496 | muramyl tripeptide Click for more detail | Mycobacteria (Bacteria) | CCCCCCCCCCCCCCCC(=O)OCC(COP(=O)(O)OCCNC(=O)C(C)NC(=O)CCC(C(=O)N)NC(=O)C(C)NC(=O)C(C)OC1C(C(OC(C1O)CO)O)NC(=O)C)OC(=O)CCCCCCCCCCCCCCC | NA | Peptide | Natural | in vitro activates Nod | PGLYRP-2 | Peptidoglycan Recognition Receptor (PGRPs) | Human | intraepithelial T lymphocytes | intracellular receptors | Q96PD5.fasta | Q96PD5 | 576 | recognises peptidoglycan of bacterial cell wall | NA | 24779390 | 2014 | Pubchem_assay |
| PRRID_1549 | Peptidoglycan (PGN) Click for more detail | Bacteria | CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N | NA | Peptidoglycan | Natural | triggers immune responses | PGN-binding proteins (PGRPs) | Peptidoglycan Recognition Receptor (PGRPs) | Mice | lymphocytes, macrophages, dendritic cells | intracellular receptors | NA | NA | NA | triggering of these receptors induces activation of the NF-κB pathway and consequently, an immune response | NA | 24779390 | 2014 | NA |
| PRRID_1549 | Peptidoglycan (PGN) Click for more detail | Bacteria | CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N | NA | Peptidoglycan | Natural | triggers immune responses | PGN-binding proteins (PGRPs) | Peptidoglycan Recognition Receptor (PGRPs) | Mice | lymphocytes, macrophages, dendritic cells | intracellular receptors | NA | NA | NA | triggering of these receptors induces activation of the NF-κB pathway and consequently, an immune response | NA | 24779390 | 2014 | NA |
| PRRID_1551 | Peptidoglycan (PGN) Click for more detail | Bacteria | CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N | NA | Peptidoglycan | Natural | triggers immune responses | PGN-binding proteins (PGRPs) | Peptidoglycan Recognition Receptor (PGRPs) | Human | lymphocytes, macrophages, dendritic cells | intracellular receptors | NA | NA | NA | triggering of these receptors induces activation of the NF-κB pathway and consequently, an immune response | NA | 24779390 | 2014 | NA |
| PRRID_1551 | Peptidoglycan (PGN) Click for more detail | Bacteria | CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N | NA | Peptidoglycan | Natural | triggers immune responses | PGN-binding proteins (PGRPs) | Peptidoglycan Recognition Receptor (PGRPs) | Human | lymphocytes, macrophages, dendritic cells | intracellular receptors | NA | NA | NA | triggering of these receptors induces activation of the NF-κB pathway and consequently, an immune response | NA | 24779390 | 2014 | NA |
| PRRID_1564 | Peptidoglycan (PGN) Click for more detail | Bacteria | CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N | NA | Peptidoglycan | Natural | NA | PGN-binding proteins (PGRPs) | Peptidoglycan Recognition Receptor (PGRPs) | NA | NA | NA | NA | NA | NA | NA | NA | 23796791 | 2014 | NA |
| PRRID_1564 | Peptidoglycan (PGN) Click for more detail | Bacteria | CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N | NA | Peptidoglycan | Natural | NA | PGN-binding proteins (PGRPs) | Peptidoglycan Recognition Receptor (PGRPs) | NA | NA | NA | NA | NA | NA | NA | NA | 23796791 | 2014 | NA |
| PRRID_1748 | GroEL Click for more detail | Pseudomonas aeruginosa (Bacteria) | DPTKVTRTALQNAASIAGLMITTEAMVAEAPKKDEPAMPPGGGMGGMGGMDF | 52 | Glycoprotein | Natural | Bacterial infection and immunostimulant | PTX3 | Peptidoglycan Recognition Receptor (PGRPs) | Human | Monocytes | NA | P26022.fasta | P26022 | 381 | NA | NA | 28031262 | 2016 | Pubchem_assay |
| PRRID_1748 | GroEL Click for more detail | Pseudomonas aeruginosa (Bacteria) | DPTKVTRTALQNAASIAGLMITTEAMVAEAPKKDEPAMPPGGGMGGMGGMDF | 52 | Glycoprotein | Natural | Bacterial infection and immunostimulant | PTX3 | Peptidoglycan Recognition Receptor (PGRPs) | Human | Monocytes | NA | P26022.fasta | P26022 | 381 | NA | NA | 28031262 | 2016 | Pubchem_assay |
| PRRID_1783 | Lipopolysaccharide (LPS) Click for more detail | Gram-negative bacteria Escherichia coli, Vibrio anguillarum | CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC | NA | Lipopolysaccharide (LPS) | Natural | Bacterial infection and immunostimulant | CgPGRPS2 | Peptidoglycan Recognition Receptor (PGRPs) | Crassostrea gigas | Cytoplasm | one typical PGRP/amidase domain | NA | NA | NA | Activate NF-kB | PAMPs binding assay | 28042081 | 2016 | NA |
| PRRID_1783 | Lipopolysaccharide (LPS) Click for more detail | Gram-negative bacteria Escherichia coli, Vibrio anguillarum | CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC | NA | Lipopolysaccharide (LPS) | Natural | Bacterial infection and immunostimulant | CgPGRPS2 | Peptidoglycan Recognition Receptor (PGRPs) | Crassostrea gigas | Cytoplasm | one typical PGRP/amidase domain | NA | NA | NA | Activate NF-kB | PAMPs binding assay | 28042081 | 2016 | NA |
| PRRID_1784 | Peptidoglycan (PGN) Click for more detail | Gram-negative bacteria Escherichia coli, Vibrio anguillarum | CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N | NA | Peptidoglycan | Natural | Bacterial infection and immunostimulant | CgPGRPS2 | Peptidoglycan Recognition Receptor (PGRPs) | Crassostrea gigas | Cytoplasm | one typical PGRP/amidase domain | NA | NA | NA | Activate NF-kB | PAMPs binding assay | 28042081 | 2016 | NA |
| PRRID_1784 | Peptidoglycan (PGN) Click for more detail | Gram-negative bacteria Escherichia coli, Vibrio anguillarum | CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N | NA | Peptidoglycan | Natural | Bacterial infection and immunostimulant | CgPGRPS2 | Peptidoglycan Recognition Receptor (PGRPs) | Crassostrea gigas | Cytoplasm | one typical PGRP/amidase domain | NA | NA | NA | Activate NF-kB | PAMPs binding assay | 28042081 | 2016 | NA |
| PRRID_1785 | Mannan Click for more detail | Gram-negative bacteria Escherichia coli, Vibrio anguillarum | CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC | NA | Polysaccharides | Natural | Bacterial infection and immunostimulant | CgPGRPS2 | Peptidoglycan Recognition Receptor (PGRPs) | Crassostrea gigas | Cytoplasm | one typical PGRP/amidase domain | NA | NA | NA | Activate NF-kB | PAMPs binding assay | 28042081 | 2016 | NA |
| PRRID_1785 | Mannan Click for more detail | Gram-negative bacteria Escherichia coli, Vibrio anguillarum | CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC | NA | Polysaccharides | Natural | Bacterial infection and immunostimulant | CgPGRPS2 | Peptidoglycan Recognition Receptor (PGRPs) | Crassostrea gigas | Cytoplasm | one typical PGRP/amidase domain | NA | NA | NA | Activate NF-kB | PAMPs binding assay | 28042081 | 2016 | NA |
| PRRID_1786 | Lipopolysaccharide (LPS) Click for more detail | Gram positive bacteria, Staphylococcus aureus and fungi Yarrowia lipolytica (Bacteria) | CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC | NA | Lipopolysaccharide (LPS) | Natural | Bacterial infection and immunostimulant | CgPGRPS2 | Peptidoglycan Recognition Receptor (PGRPs) | Crassostrea gigas | Cytoplasm | one typical PGRP/amidase domain | NA | NA | NA | Activate NF-kB | PAMPs binding assay | 28042081 | 2016 | NA |
| PRRID_1786 | Lipopolysaccharide (LPS) Click for more detail | Gram positive bacteria, Staphylococcus aureus and fungi Yarrowia lipolytica (Bacteria) | CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC | NA | Lipopolysaccharide (LPS) | Natural | Bacterial infection and immunostimulant | CgPGRPS2 | Peptidoglycan Recognition Receptor (PGRPs) | Crassostrea gigas | Cytoplasm | one typical PGRP/amidase domain | NA | NA | NA | Activate NF-kB | PAMPs binding assay | 28042081 | 2016 | NA |
| PRRID_1787 | Peptidoglycan (PGN) Click for more detail | Gram positive bacteria, Staphylococcus aureus and fungi Yarrowia lipolytica (Bacteria) | CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N | NA | Peptidoglycan | Natural | Bacterial infection and immunostimulant | CgPGRPS2 | Peptidoglycan Recognition Receptor (PGRPs) | Crassostrea gigas | Cytoplasm | one typical PGRP/amidase domain | NA | NA | NA | Activate NF-kB | PAMPs binding assay | 28042081 | 2016 | NA |
| PRRID_1787 | Peptidoglycan (PGN) Click for more detail | Gram positive bacteria, Staphylococcus aureus and fungi Yarrowia lipolytica (Bacteria) | CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N | NA | Peptidoglycan | Natural | Bacterial infection and immunostimulant | CgPGRPS2 | Peptidoglycan Recognition Receptor (PGRPs) | Crassostrea gigas | Cytoplasm | one typical PGRP/amidase domain | NA | NA | NA | Activate NF-kB | PAMPs binding assay | 28042081 | 2016 | NA |
| PRRID_1788 | Mannan Click for more detail | Gram positive bacteria, Staphylococcus aureus and fungi Yarrowia lipolytica (Bacteria) | CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC | NA | Polysaccharides | Natural | Bacterial infection and immunostimulant | CgPGRPS2 | Peptidoglycan Recognition Receptor (PGRPs) | Crassostrea gigas | Cytoplasm | one typical PGRP/amidase domain | NA | NA | NA | Activate NF-kB | PAMPs binding assay | 28042081 | 2016 | NA |
| PRRID_1788 | Mannan Click for more detail | Gram positive bacteria, Staphylococcus aureus and fungi Yarrowia lipolytica (Bacteria) | CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC | NA | Polysaccharides | Natural | Bacterial infection and immunostimulant | CgPGRPS2 | Peptidoglycan Recognition Receptor (PGRPs) | Crassostrea gigas | Cytoplasm | one typical PGRP/amidase domain | NA | NA | NA | Activate NF-kB | PAMPs binding assay | 28042081 | 2016 | NA |
| PRRID_1826 | NA Click for more detail | V. anguillarum (Bacteria) | NA | NA | Pattern-associated molecular patterns (PAMPs) | Natural | Immunostimulant | SmPGRP2 | Peptidoglycan Recognition Receptor (PGRPs) | Scophthalmus maximus | liver, spleen, and head-kidney,intestine, gill and skin | NA | NA | NA | NA | Activate NF-KB | qRT-PCR | 27461422 | 2016 | NA |
| PRRID_1826 | NA Click for more detail | V. anguillarum (Bacteria) | NA | NA | Pattern-associated molecular patterns (PAMPs) | Natural | Immunostimulant | SmPGRP2 | Peptidoglycan Recognition Receptor (PGRPs) | Scophthalmus maximus | liver, spleen, and head-kidney,intestine, gill and skin | NA | NA | NA | NA | Activate NF-KB | qRT-PCR | 27461422 | 2016 | NA |
| PRRID_1839 | Peptidoglycan (PGN) Click for more detail | Bacteria | CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N | NA | Peptidoglycan | Natural | Bacterial infection | CgPGRPS4 | Peptidoglycan Recognition Receptor (PGRPs) | Crassostrea gigas | Cytoplasm | one typical PGRP/amidase domain | NA | NA | NA | Activate NF-kB | PAMPs binding assay | 28042081 | 2016 | NA |
| PRRID_1839 | Peptidoglycan (PGN) Click for more detail | Bacteria | CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N | NA | Peptidoglycan | Natural | Bacterial infection | CgPGRPS4 | Peptidoglycan Recognition Receptor (PGRPs) | Crassostrea gigas | Cytoplasm | one typical PGRP/amidase domain | NA | NA | NA | Activate NF-kB | PAMPs binding assay | 28042081 | 2016 | NA |
| PRRID_2015 | E. tarda Click for more detail | Gram negative Bacteria (Bacteria) | NA | NA | NA | Natural | infection | AdPGRP-S1 | Peptidoglycan Recognition Receptor (PGRPs) | Chinese giant salamander (Andrias davidianus) | intestine and skin | PGRP domain | NA | NA | NA | NA | Antibacterial activity assay | 29245904 | 2017 | NA |
| PRRID_2015 | E. tarda Click for more detail | Gram negative Bacteria (Bacteria) | NA | NA | NA | Natural | infection | AdPGRP-S1 | Peptidoglycan Recognition Receptor (PGRPs) | Chinese giant salamander (Andrias davidianus) | intestine and skin | PGRP domain | NA | NA | NA | NA | Antibacterial activity assay | 29245904 | 2017 | NA |
| PRRID_2707 | Lys-type Click for more detail | Gram-negative E. Coli and L. anguillarum, as well as Gram-positive M. | NA | NA | Protein | Natural | NA | rSgPGRP-S1 | Peptidoglycan Recognition Receptor (PGRPs) | NA | NA | NA | NA | NA | NA | NA | NA | 29208495 | 2018 | NA |
| PRRID_2707 | Lys-type Click for more detail | Gram-negative E. Coli and L. anguillarum, as well as Gram-positive M. | NA | NA | Protein | Natural | NA | rSgPGRP-S1 | Peptidoglycan Recognition Receptor (PGRPs) | NA | NA | NA | NA | NA | NA | NA | NA | 29208495 | 2018 | NA |
| PRRID_2739 | Dap-type PGN Click for more detail | Gram-negative E. Coli and L. anguillarum, as well as Gram-positive M. | CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N | NA | Protein | Natural | NA | rSgPGRP-S1 | Peptidoglycan Recognition Receptor (PGRPs) | NA | NA | NA | NA | NA | NA | NA | NA | 29208495 | 2018 | NA |
| PRRID_2739 | Dap-type PGN Click for more detail | Gram-negative E. Coli and L. anguillarum, as well as Gram-positive M. | CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N | NA | Protein | Natural | NA | rSgPGRP-S1 | Peptidoglycan Recognition Receptor (PGRPs) | NA | NA | NA | NA | NA | NA | NA | NA | 29208495 | 2018 | NA |