Browse result page of PRRDB 2.0
| PRRID | Name of Ligand | Source of ligand | Sequence of Ligand | Length of Ligand | Type of Ligand | Occurence | Role of Ligand | Name of Receptor | Type of Reeptor | Source of the Receptor | Localization | Domain | Sequence of Receptor | Swiss prot ID | Length of receptor | Function of Receptor | Assay used | PMID | Year of publication | Pubchem assay |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| PRRID_2199 | Hyaluronan Click for more detail | NA | CC(=O)NC1CC(C(OC1OC2C(C(C(OC2C(=O)[O-])O)O)O)CO)O | NA | Damage-associated molecular patterns (DAMPs) | Natural | Induce the production of TNF-α, IL-1β and IL-12 by dendritic cells | Nod-like receptor P3 (NLRP3) | NOD-like receptor (NLR) | Human | dendritic cells | NA | Q96P20.fasta | Q96P20 | 1036 | NA | NA | 28961019 | 2017 | Pubchem_assay |
| PRRID_2199 | Hyaluronan Click for more detail | NA | CC(=O)NC1CC(C(OC1OC2C(C(C(OC2C(=O)[O-])O)O)O)CO)O | NA | Damage-associated molecular patterns (DAMPs) | Natural | Induce the production of TNF-α, IL-1β and IL-12 by dendritic cells | Nod-like receptor P3 (NLRP3) | NOD-like receptor (NLR) | Human | dendritic cells | NA | Q96P20.fasta | Q96P20 | 1036 | NA | NA | 28961019 | 2017 | Pubchem_assay |
| PRRID_2200 | Hyaluronan Click for more detail | NA | CC(=O)NC1CC(C(OC1OC2C(C(C(OC2C(=O)[O-])O)O)O)CO)O | NA | Damage-associated molecular patterns (DAMPs) | Natural | Induce the production of TNF-α, IL-1β and IL-12 by dendritic cells | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Human | dendritic cells | NA | O00206.fasta | O00206 | 839 | NA | NA | 28961019 | 2017 | Pubchem_assay |
| PRRID_2200 | Hyaluronan Click for more detail | NA | CC(=O)NC1CC(C(OC1OC2C(C(C(OC2C(=O)[O-])O)O)O)CO)O | NA | Damage-associated molecular patterns (DAMPs) | Natural | Induce the production of TNF-α, IL-1β and IL-12 by dendritic cells | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Human | dendritic cells | NA | O00206.fasta | O00206 | 839 | NA | NA | 28961019 | 2017 | Pubchem_assay |
| PRRID_2201 | Hyaluronic acid Click for more detail | NA | CC(=O)NC1CC(C(OC1OC2C(C(C(OC2C(=O)[O-])O)O)O)CO)O | NA | Damage-associated molecular patterns (DAMPs) | Natural | Induce the maturation of mouse and human dendritic cells, | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Human | Endothelial cells | NA | O60603.fasta | O60603 | 784 | NA | NA | 28961019 | 2017 | Pubchem_assay |
| PRRID_2201 | Hyaluronic acid Click for more detail | NA | CC(=O)NC1CC(C(OC1OC2C(C(C(OC2C(=O)[O-])O)O)O)CO)O | NA | Damage-associated molecular patterns (DAMPs) | Natural | Induce the maturation of mouse and human dendritic cells, | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Human | Endothelial cells | NA | O60603.fasta | O60603 | 784 | NA | NA | 28961019 | 2017 | Pubchem_assay |
| PRRID_2202 | Hyaluronic acid Click for more detail | NA | CC(=O)NC1CC(C(OC1OC2C(C(C(OC2C(=O)[O-])O)O)O)CO)O | NA | Damage-associated molecular patterns (DAMPs) | Natural | Induce the maturation of mouse and human dendritic cells, | Nod-like receptor P3 (NLRP3) | NOD-like receptor (NLR) | Human | Endothelial cells | NA | Q96P20.fasta | Q96P20 | 1036 | NA | NA | 28961019 | 2017 | Pubchem_assay |
| PRRID_2202 | Hyaluronic acid Click for more detail | NA | CC(=O)NC1CC(C(OC1OC2C(C(C(OC2C(=O)[O-])O)O)O)CO)O | NA | Damage-associated molecular patterns (DAMPs) | Natural | Induce the maturation of mouse and human dendritic cells, | Nod-like receptor P3 (NLRP3) | NOD-like receptor (NLR) | Human | Endothelial cells | NA | Q96P20.fasta | Q96P20 | 1036 | NA | NA | 28961019 | 2017 | Pubchem_assay |
| PRRID_2203 | Hyaluronic acid Click for more detail | NA | CC(=O)NC1CC(C(OC1OC2C(C(C(OC2C(=O)[O-])O)O)O)CO)O | NA | Damage-associated molecular patterns (DAMPs) | Natural | Induce the maturation of mouse and human dendritic cells, | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Human | Endothelial cells | NA | O00206.fasta | O00206 | 839 | NA | NA | 28961019 | 2017 | Pubchem_assay |
| PRRID_2203 | Hyaluronic acid Click for more detail | NA | CC(=O)NC1CC(C(OC1OC2C(C(C(OC2C(=O)[O-])O)O)O)CO)O | NA | Damage-associated molecular patterns (DAMPs) | Natural | Induce the maturation of mouse and human dendritic cells, | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Human | Endothelial cells | NA | O00206.fasta | O00206 | 839 | NA | NA | 28961019 | 2017 | Pubchem_assay |
| PRRID_2204 | Hyaluronic acid Click for more detail | NA | CC(=O)NC1CC(C(OC1OC2C(C(C(OC2C(=O)[O-])O)O)O)CO)O | NA | Damage-associated molecular patterns (DAMPs) | Natural | Induce the production of TNF-α, IL-1β and IL-12 by dendritic cells | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Mice (Murine) | Macrophages | NA | Q9QUN7.fasta | Q9QUN7 | 784 | NA | NA | 28961019 | 2017 | Pubchem_assay |
| PRRID_2204 | Hyaluronic acid Click for more detail | NA | CC(=O)NC1CC(C(OC1OC2C(C(C(OC2C(=O)[O-])O)O)O)CO)O | NA | Damage-associated molecular patterns (DAMPs) | Natural | Induce the production of TNF-α, IL-1β and IL-12 by dendritic cells | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Mice (Murine) | Macrophages | NA | Q9QUN7.fasta | Q9QUN7 | 784 | NA | NA | 28961019 | 2017 | Pubchem_assay |
| PRRID_2205 | Hyaluronic acid Click for more detail | NA | CC(=O)NC1CC(C(OC1OC2C(C(C(OC2C(=O)[O-])O)O)O)CO)O | NA | Damage-associated molecular patterns (DAMPs) | Natural | Induce the production of TNF-α, IL-1β and IL-12 by dendritic cells | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Human | Endothelial cells | NA | O60603.fasta | O60603 | 784 | NA | NA | 28961019 | 2017 | Pubchem_assay |
| PRRID_2205 | Hyaluronic acid Click for more detail | NA | CC(=O)NC1CC(C(OC1OC2C(C(C(OC2C(=O)[O-])O)O)O)CO)O | NA | Damage-associated molecular patterns (DAMPs) | Natural | Induce the production of TNF-α, IL-1β and IL-12 by dendritic cells | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Human | Endothelial cells | NA | O60603.fasta | O60603 | 784 | NA | NA | 28961019 | 2017 | Pubchem_assay |
| PRRID_2206 | Hyaluronic acid Click for more detail | NA | CC(=O)NC1CC(C(OC1OC2C(C(C(OC2C(=O)[O-])O)O)O)CO)O | NA | Damage-associated molecular patterns (DAMPs) | Natural | Induce the production of TNF-α, IL-1β and IL-12 by dendritic cells | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Human | Endothelial cells | NA | O00206.fasta | O00206 | 839 | NA | NA | 28961019 | 2017 | Pubchem_assay |
| PRRID_2206 | Hyaluronic acid Click for more detail | NA | CC(=O)NC1CC(C(OC1OC2C(C(C(OC2C(=O)[O-])O)O)O)CO)O | NA | Damage-associated molecular patterns (DAMPs) | Natural | Induce the production of TNF-α, IL-1β and IL-12 by dendritic cells | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Human | Endothelial cells | NA | O00206.fasta | O00206 | 839 | NA | NA | 28961019 | 2017 | Pubchem_assay |
| PRRID_2207 | Hyaluronic acid Click for more detail | NA | CC(=O)NC1CC(C(OC1OC2C(C(C(OC2C(=O)[O-])O)O)O)CO)O | NA | Damage-associated molecular patterns (DAMPs) | Natural | Induce the production of TNF-α, IL-1β and IL-12 by dendritic cells | Nod-like receptor P3 (NLRP3) | NOD-like receptor (NLR) | Human | Endothelial cells | NA | Q96P20.fasta | Q96P20 | 1036 | NA | NA | 28961019 | 2017 | Pubchem_assay |
| PRRID_2207 | Hyaluronic acid Click for more detail | NA | CC(=O)NC1CC(C(OC1OC2C(C(C(OC2C(=O)[O-])O)O)O)CO)O | NA | Damage-associated molecular patterns (DAMPs) | Natural | Induce the production of TNF-α, IL-1β and IL-12 by dendritic cells | Nod-like receptor P3 (NLRP3) | NOD-like receptor (NLR) | Human | Endothelial cells | NA | Q96P20.fasta | Q96P20 | 1036 | NA | NA | 28961019 | 2017 | Pubchem_assay |
| PRRID_2305 | LMW-HA Click for more detail | Glycosaminoglycan (others) | NA | NA | Damage-associated molecular patterns (DAMPs) | Natural | involved in the resolution and fine-tuning of inflammation by orchestrating the production of anti-inflammatory mediators that are required for the resolution of tissue inflammation and the transition to acquired immunity | cluster of differentiation 44 (CD44) | Pattern recognition receptor (PRR) | NA | NA | NA | NA | NA | NA | NA | NA | 29290139 | 2017 | NA |
| PRRID_2305 | LMW-HA Click for more detail | Glycosaminoglycan (others) | NA | NA | Damage-associated molecular patterns (DAMPs) | Natural | involved in the resolution and fine-tuning of inflammation by orchestrating the production of anti-inflammatory mediators that are required for the resolution of tissue inflammation and the transition to acquired immunity | cluster of differentiation 44 (CD44) | Pattern recognition receptor (PRR) | NA | NA | NA | NA | NA | NA | NA | NA | 29290139 | 2017 | NA |
| PRRID_2306 | LMW-HA Click for more detail | Glycosaminoglycan (others) | NA | NA | Damage-associated molecular patterns (DAMPs) | Natural | involved in the resolution and fine-tuning of inflammation by orchestrating the production of anti-inflammatory mediators that are required for the resolution of tissue inflammation and the transition to acquired immunity | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | NA | NA | NA | NA | NA | NA | NA | NA | 29290139 | 2017 | NA |
| PRRID_2306 | LMW-HA Click for more detail | Glycosaminoglycan (others) | NA | NA | Damage-associated molecular patterns (DAMPs) | Natural | involved in the resolution and fine-tuning of inflammation by orchestrating the production of anti-inflammatory mediators that are required for the resolution of tissue inflammation and the transition to acquired immunity | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | NA | NA | NA | NA | NA | NA | NA | NA | 29290139 | 2017 | NA |
| PRRID_2307 | LMW-HA Click for more detail | Glycosaminoglycan (others) | NA | NA | Damage-associated molecular patterns (DAMPs) | Natural | involved in the resolution and fine-tuning of inflammation by orchestrating the production of anti-inflammatory mediators that are required for the resolution of tissue inflammation and the transition to acquired immunity | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | NA | NA | NA | NA | NA | NA | NA | NA | 29290139 | 2017 | NA |
| PRRID_2307 | LMW-HA Click for more detail | Glycosaminoglycan (others) | NA | NA | Damage-associated molecular patterns (DAMPs) | Natural | involved in the resolution and fine-tuning of inflammation by orchestrating the production of anti-inflammatory mediators that are required for the resolution of tissue inflammation and the transition to acquired immunity | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | NA | NA | NA | NA | NA | NA | NA | NA | 29290139 | 2017 | NA |
| PRRID_2308 | LMW-HA Click for more detail | Glycosaminoglycan (others) | NA | NA | Damage-associated molecular patterns (DAMPs) | Natural | involved in the resolution and fine-tuning of inflammation by orchestrating the production of anti-inflammatory mediators that are required for the resolution of tissue inflammation and the transition to acquired immunity | Nod-like receptor P3 (NLRP3) | NOD-like receptor (NLR) | NA | NA | NA | NA | NA | NA | NA | NA | 29290139 | 2017 | NA |
| PRRID_2308 | LMW-HA Click for more detail | Glycosaminoglycan (others) | NA | NA | Damage-associated molecular patterns (DAMPs) | Natural | involved in the resolution and fine-tuning of inflammation by orchestrating the production of anti-inflammatory mediators that are required for the resolution of tissue inflammation and the transition to acquired immunity | Nod-like receptor P3 (NLRP3) | NOD-like receptor (NLR) | NA | NA | NA | NA | NA | NA | NA | NA | 29290139 | 2017 | NA |
| PRRID_2358 | Myosin Click for more detail | Cytosol, endosome(others) | NA | NA | Damage-associated molecular patterns (DAMPs) | Natural | involved in the resolution and fine-tuning of inflammation by orchestrating the production of anti-inflammatory mediators that are required for the resolution of tissue inflammation and the transition to acquired immunity | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | NA | NA | Leucine-rich Repeat (LRR) Domain | NA | NA | NA | NA | NA | 29290139 | 2017 | NA |
| PRRID_2358 | Myosin Click for more detail | Cytosol, endosome(others) | NA | NA | Damage-associated molecular patterns (DAMPs) | Natural | involved in the resolution and fine-tuning of inflammation by orchestrating the production of anti-inflammatory mediators that are required for the resolution of tissue inflammation and the transition to acquired immunity | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | NA | NA | Leucine-rich Repeat (LRR) Domain | NA | NA | NA | NA | NA | 29290139 | 2017 | NA |
| PRRID_2359 | Myosin Click for more detail | Cytosol, endosome(others) | NA | NA | Damage-associated molecular patterns (DAMPs) | Natural | involved in the resolution and fine-tuning of inflammation by orchestrating the production of anti-inflammatory mediators that are required for the resolution of tissue inflammation and the transition to acquired immunity | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | NA | NA | Leucine-rich Repeat (LRR) Domain | NA | NA | NA | NA | NA | 29290139 | 2017 | NA |
| PRRID_2359 | Myosin Click for more detail | Cytosol, endosome(others) | NA | NA | Damage-associated molecular patterns (DAMPs) | Natural | involved in the resolution and fine-tuning of inflammation by orchestrating the production of anti-inflammatory mediators that are required for the resolution of tissue inflammation and the transition to acquired immunity | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | NA | NA | Leucine-rich Repeat (LRR) Domain | NA | NA | NA | NA | NA | 29290139 | 2017 | NA |
| PRRID_2360 | Myosin Click for more detail | Cytosol, endosome(others) | NA | NA | Damage-associated molecular patterns (DAMPs) | Natural | involved in the resolution and fine-tuning of inflammation by orchestrating the production of anti-inflammatory mediators that are required for the resolution of tissue inflammation and the transition to acquired immunity | RAGE | Receptor for advanced glycation endproducts (RAGE) | NA | NA | Leucine-rich Repeat (LRR) Domain | NA | NA | NA | NA | NA | 29290139 | 2017 | NA |
| PRRID_2360 | Myosin Click for more detail | Cytosol, endosome(others) | NA | NA | Damage-associated molecular patterns (DAMPs) | Natural | involved in the resolution and fine-tuning of inflammation by orchestrating the production of anti-inflammatory mediators that are required for the resolution of tissue inflammation and the transition to acquired immunity | RAGE | Receptor for advanced glycation endproducts (RAGE) | NA | NA | Leucine-rich Repeat (LRR) Domain | NA | NA | NA | NA | NA | 29290139 | 2017 | NA |
| PRRID_2443 | NA Click for more detail | E. coli(Bacteria) | MKIKTGARILALSALTTMMFSASALAKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTRITK | 396 | Damage-associated molecular patterns (DAMPs) | Natural | elicit innate immune response | CTLMA2 | C type Lectin (CTL/CLR) | Anopheles gambiae | NA | NA | B2FX57.fasta | B2FX57 | 165 | NA | NA | 29051762 | 2017 | Pubchem_assay |
| PRRID_2443 | NA Click for more detail | E. coli(Bacteria) | MKIKTGARILALSALTTMMFSASALAKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTRITK | 396 | Damage-associated molecular patterns (DAMPs) | Natural | elicit innate immune response | CTLMA2 | C type Lectin (CTL/CLR) | Anopheles gambiae | NA | NA | B2FX57.fasta | B2FX57 | 165 | NA | NA | 29051762 | 2017 | Pubchem_assay |
| PRRID_2444 | NA Click for more detail | E. caproni(others) | NA | NA | Damage-associated molecular patterns (DAMPs) | Natural | NA | hemoglobin-2 | non-canonical proteins interacting with pathogens (NCIP), | NA | NA | NA | NA | NA | NA | NA | NA | 29051762 | 2017 | NA |
| PRRID_2444 | NA Click for more detail | E. caproni(others) | NA | NA | Damage-associated molecular patterns (DAMPs) | Natural | NA | hemoglobin-2 | non-canonical proteins interacting with pathogens (NCIP), | NA | NA | NA | NA | NA | NA | NA | NA | 29051762 | 2017 | NA |
| PRRID_2592 | RNA Click for more detail | All vertebrates(others) | NA | NA | Damage-associated molecular patterns (DAMPs) | Natural | Cellular injury and necrosis | Toll-like receptor 3 (TLR3) | Toll-like receptor (TLR) | Human | NA | Leucine-rich Repeat (LRR) Domain | O15455.fasta | O15455 | 904 | Activate NF-KB | NA | 28049142 | 2017 | Pubchem_assay |
| PRRID_2592 | RNA Click for more detail | All vertebrates(others) | NA | NA | Damage-associated molecular patterns (DAMPs) | Natural | Cellular injury and necrosis | Toll-like receptor 3 (TLR3) | Toll-like receptor (TLR) | Human | NA | Leucine-rich Repeat (LRR) Domain | O15455.fasta | O15455 | 904 | Activate NF-KB | NA | 28049142 | 2017 | Pubchem_assay |
| PRRID_2595 | ROS Click for more detail | NA | NA | NA | Damage-associated molecular patterns (DAMPs) | Natural | NA | Nod-like receptor P3 (NLRP3) | NOD-like receptor (NLR) | Mice | Microglia | NA | Q8R4B8.fasta | Q8R4B8 | 1033 | NLRP3 inflammasome activation in AD models | NA | 28805121 | 2017 | Pubchem_assay |
| PRRID_2595 | ROS Click for more detail | NA | NA | NA | Damage-associated molecular patterns (DAMPs) | Natural | NA | Nod-like receptor P3 (NLRP3) | NOD-like receptor (NLR) | Mice | Microglia | NA | Q8R4B8.fasta | Q8R4B8 | 1033 | NLRP3 inflammasome activation in AD models | NA | 28805121 | 2017 | Pubchem_assay |
| PRRID_2596 | ROS Click for more detail | NA | NA | NA | Damage-associated molecular patterns (DAMPs) | Natural | NA | Nod-like receptor P3 (NLRP3) | NOD-like receptor (NLR) | Mice | cortical neurons (cell culture, stroke model) | NA | Q8R4B8.fasta | Q8R4B8 | 1033 | protein ‚Üë in ischemia/reperfusion, role in neuronal cell death and behavioral deficits | NA | 28801521 | 2017 | Pubchem_assay |
| PRRID_2596 | ROS Click for more detail | NA | NA | NA | Damage-associated molecular patterns (DAMPs) | Natural | NA | Nod-like receptor P3 (NLRP3) | NOD-like receptor (NLR) | Mice | cortical neurons (cell culture, stroke model) | NA | Q8R4B8.fasta | Q8R4B8 | 1033 | protein ‚Üë in ischemia/reperfusion, role in neuronal cell death and behavioral deficits | NA | 28801521 | 2017 | Pubchem_assay |
| PRRID_2597 | ROS Click for more detail | NA | NA | NA | Damage-associated molecular patterns (DAMPs) | Natural | NA | Nod-like receptor P3 (NLRP3) | NOD-like receptor (NLR) | Human | Brain | NA | Q96P20.fasta | Q96P20 | 1036 | protein ‚Üë in ischemia/reperfusion, role in neuronal cell death and behavioral deficits | NA | 28801521 | 2017 | Pubchem_assay |
| PRRID_2597 | ROS Click for more detail | NA | NA | NA | Damage-associated molecular patterns (DAMPs) | Natural | NA | Nod-like receptor P3 (NLRP3) | NOD-like receptor (NLR) | Human | Brain | NA | Q96P20.fasta | Q96P20 | 1036 | protein ‚Üë in ischemia/reperfusion, role in neuronal cell death and behavioral deficits | NA | 28801521 | 2017 | Pubchem_assay |
| PRRID_2598 | ROS Click for more detail | NA | NA | NA | Damage-associated molecular patterns (DAMPs) | Natural | NA | Nod-like receptor P3 (NLRP3) | NOD-like receptor (NLR) | Rat | primary astrocytes | NA | D4A523.fasta | D4A523 | 1035 | protein ‚Üë, activation of NLRP3 inflammasome in PD models | NA | 28801521 | 2017 | Pubchem_assay |
| PRRID_2598 | ROS Click for more detail | NA | NA | NA | Damage-associated molecular patterns (DAMPs) | Natural | NA | Nod-like receptor P3 (NLRP3) | NOD-like receptor (NLR) | Rat | primary astrocytes | NA | D4A523.fasta | D4A523 | 1035 | protein ‚Üë, activation of NLRP3 inflammasome in PD models | NA | 28801521 | 2017 | Pubchem_assay |
| PRRID_2599 | ROS Click for more detail | NA | NA | NA | Damage-associated molecular patterns (DAMPs) | Natural | NA | Nod-like receptor P3 (NLRP3) | NOD-like receptor (NLR) | Mice | substantia nigra | NA | Q8R4B8.fasta | Q8R4B8 | 1033 | protein ‚Üë, activation of NLRP3 inflammasome in PD models | NA | 28801521 | 2017 | Pubchem_assay |
| PRRID_2599 | ROS Click for more detail | NA | NA | NA | Damage-associated molecular patterns (DAMPs) | Natural | NA | Nod-like receptor P3 (NLRP3) | NOD-like receptor (NLR) | Mice | substantia nigra | NA | Q8R4B8.fasta | Q8R4B8 | 1033 | protein ‚Üë, activation of NLRP3 inflammasome in PD models | NA | 28801521 | 2017 | Pubchem_assay |
| PRRID_2600 | ATP Click for more detail | NA | C1=NC2=C(C(=N1)N)N=CN2C3C(C(C(O3)COP(=O)(O)OP(=O)(O)OP(=O)(O)O)O)O | NA | Damage-associated molecular patterns (DAMPs) | Natural | NA | Nod-like receptor P3 (NLRP3) | NOD-like receptor (NLR) | Mice | Microglia | NA | Q8R4B8.fasta | Q8R4B8 | 1033 | NLRP3 inflammasome activation in AD models | NA | 28801521 | 2017 | Pubchem_assay |
| PRRID_2600 | ATP Click for more detail | NA | C1=NC2=C(C(=N1)N)N=CN2C3C(C(C(O3)COP(=O)(O)OP(=O)(O)OP(=O)(O)O)O)O | NA | Damage-associated molecular patterns (DAMPs) | Natural | NA | Nod-like receptor P3 (NLRP3) | NOD-like receptor (NLR) | Mice | Microglia | NA | Q8R4B8.fasta | Q8R4B8 | 1033 | NLRP3 inflammasome activation in AD models | NA | 28801521 | 2017 | Pubchem_assay |
| PRRID_2601 | S100 proteins Click for more detail | Cytosol(others) | MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE | 92 | Damage-associated molecular patterns (DAMPs) | Natural | involved in the resolution and fine-tuning of inflammation by orchestrating the production of anti-inflammatory mediators that are required for the resolution of tissue inflammation and the transition to acquired immunity | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | NA | NA | extracellular domain formed by three immunoglobulin domains (V-C1-C2), a single transmembrane domain and cytosolic portions. | NA | NA | NA | NA | NA | 29290139 | 2017 | NA |
| PRRID_2601 | S100 proteins Click for more detail | Cytosol(others) | MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE | 92 | Damage-associated molecular patterns (DAMPs) | Natural | involved in the resolution and fine-tuning of inflammation by orchestrating the production of anti-inflammatory mediators that are required for the resolution of tissue inflammation and the transition to acquired immunity | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | NA | NA | extracellular domain formed by three immunoglobulin domains (V-C1-C2), a single transmembrane domain and cytosolic portions. | NA | NA | NA | NA | NA | 29290139 | 2017 | NA |
| PRRID_2602 | S100 proteins Click for more detail | Cytosol(others) | MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE | 92 | Damage-associated molecular patterns (DAMPs) | Natural | involved in the resolution and fine-tuning of inflammation by orchestrating the production of anti-inflammatory mediators that are required for the resolution of tissue inflammation and the transition to acquired immunity | RAGE | Receptor for advanced glycation endproducts (RAGE) | NA | NA | extracellular domain formed by three immunoglobulin domains (V-C1-C2), a single transmembrane domain and cytosolic portions. | NA | NA | NA | NA | NA | 29290139 | 2017 | NA |
| PRRID_2602 | S100 proteins Click for more detail | Cytosol(others) | MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE | 92 | Damage-associated molecular patterns (DAMPs) | Natural | involved in the resolution and fine-tuning of inflammation by orchestrating the production of anti-inflammatory mediators that are required for the resolution of tissue inflammation and the transition to acquired immunity | RAGE | Receptor for advanced glycation endproducts (RAGE) | NA | NA | extracellular domain formed by three immunoglobulin domains (V-C1-C2), a single transmembrane domain and cytosolic portions. | NA | NA | NA | NA | NA | 29290139 | 2017 | NA |
| PRRID_2603 | S100 proteins Click for more detail | NA | MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE | 92 | Damage-associated molecular patterns (DAMPs) | Natural | acts as stimulator of cell pro- liferation and migration and inhibitor of apoptosis and differ- entiation, | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Human | NA | Leucine-rich Repeat (LRR) Domain | O60603.fasta | O60603 | 784 | Activate NF-KB | NA | 28049142 | 2017 | Pubchem_assay |
| PRRID_2603 | S100 proteins Click for more detail | NA | MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE | 92 | Damage-associated molecular patterns (DAMPs) | Natural | acts as stimulator of cell pro- liferation and migration and inhibitor of apoptosis and differ- entiation, | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Human | NA | Leucine-rich Repeat (LRR) Domain | O60603.fasta | O60603 | 784 | Activate NF-KB | NA | 28049142 | 2017 | Pubchem_assay |
| PRRID_2604 | S100 proteins Click for more detail | NA | MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE | 92 | Damage-associated molecular patterns (DAMPs) | Natural | acts as stimulator of cell pro- liferation and migration and inhibitor of apoptosis and differ- entiation, | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Human | NA | Leucine-rich Repeat (LRR) Domain | O00206.fasta | O00206 | 839 | Activate NF-KB | NA | 28049142 | 2017 | Pubchem_assay |
| PRRID_2604 | S100 proteins Click for more detail | NA | MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE | 92 | Damage-associated molecular patterns (DAMPs) | Natural | acts as stimulator of cell pro- liferation and migration and inhibitor of apoptosis and differ- entiation, | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Human | NA | Leucine-rich Repeat (LRR) Domain | O00206.fasta | O00206 | 839 | Activate NF-KB | NA | 28049142 | 2017 | Pubchem_assay |
| PRRID_2605 | S100 proteins Click for more detail | NA | MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE | 92 | Damage-associated molecular patterns (DAMPs) | Natural | acts as stimulator of cell pro- liferation and migration and inhibitor of apoptosis and differ- entiation, | RAGE | Receptor for advanced glycation endproducts (RAGE) | Human | NA | NA | Q15109.fasta | Q15109 | 404 | Activate NF-KB | NA | 28049142 | 2017 | Pubchem_assay |
| PRRID_2605 | S100 proteins Click for more detail | NA | MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE | 92 | Damage-associated molecular patterns (DAMPs) | Natural | acts as stimulator of cell pro- liferation and migration and inhibitor of apoptosis and differ- entiation, | RAGE | Receptor for advanced glycation endproducts (RAGE) | Human | NA | NA | Q15109.fasta | Q15109 | 404 | Activate NF-KB | NA | 28049142 | 2017 | Pubchem_assay |
| PRRID_2606 | S100 proteins Click for more detail | NA | MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE | 92 | Damage-associated molecular patterns (DAMPs) | Natural | Promote human neutrophil migration | RAGE | Receptor for advanced glycation endproducts (RAGE) | Human | Neutrophils | NA | Q15109.fasta | Q15109 | 404 | NA | NA | 28961019 | 2017 | Pubchem_assay |
| PRRID_2606 | S100 proteins Click for more detail | NA | MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE | 92 | Damage-associated molecular patterns (DAMPs) | Natural | Promote human neutrophil migration | RAGE | Receptor for advanced glycation endproducts (RAGE) | Human | Neutrophils | NA | Q15109.fasta | Q15109 | 404 | NA | NA | 28961019 | 2017 | Pubchem_assay |
| PRRID_2607 | S100 proteins Click for more detail | NA | MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE | 92 | Damage-associated molecular patterns (DAMPs) | Natural | Promote human neutrophil migration | RAGE | Receptor for advanced glycation endproducts (RAGE) | Human | Neutrophils | NA | Q15109.fasta | Q15109 | 404 | NA | NA | 28961019 | 2017 | Pubchem_assay |
| PRRID_2607 | S100 proteins Click for more detail | NA | MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE | 92 | Damage-associated molecular patterns (DAMPs) | Natural | Promote human neutrophil migration | RAGE | Receptor for advanced glycation endproducts (RAGE) | Human | Neutrophils | NA | Q15109.fasta | Q15109 | 404 | NA | NA | 28961019 | 2017 | Pubchem_assay |
| PRRID_2608 | S100 proteins Click for more detail | NA | MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE | 92 | Damage-associated molecular patterns (DAMPs) | Natural | Induce the production of TNF-α, IL-1β, and IL-12 by human monocytes | RAGE | Receptor for advanced glycation endproducts (RAGE) | Human | Monocyte | NA | Q15109.fasta | Q15109 | 404 | NA | NA | 28961019 | 2017 | Pubchem_assay |
| PRRID_2608 | S100 proteins Click for more detail | NA | MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE | 92 | Damage-associated molecular patterns (DAMPs) | Natural | Induce the production of TNF-α, IL-1β, and IL-12 by human monocytes | RAGE | Receptor for advanced glycation endproducts (RAGE) | Human | Monocyte | NA | Q15109.fasta | Q15109 | 404 | NA | NA | 28961019 | 2017 | Pubchem_assay |
| PRRID_2609 | S100 proteins Click for more detail | NA | MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE | 92 | Damage-associated molecular patterns (DAMPs) | Natural | Induce the production of TNF-α, IL-1β, and IL-12 by human monocytes | RAGE | Receptor for advanced glycation endproducts (RAGE) | Human | Monocyte | NA | Q15109.fasta | Q15109 | 404 | NA | NA | 28961019 | 2017 | Pubchem_assay |
| PRRID_2609 | S100 proteins Click for more detail | NA | MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE | 92 | Damage-associated molecular patterns (DAMPs) | Natural | Induce the production of TNF-α, IL-1β, and IL-12 by human monocytes | RAGE | Receptor for advanced glycation endproducts (RAGE) | Human | Monocyte | NA | Q15109.fasta | Q15109 | 404 | NA | NA | 28961019 | 2017 | Pubchem_assay |
| PRRID_2610 | S100 proteins Click for more detail | NA | MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE | 92 | Damage-associated molecular patterns (DAMPs) | Natural | Induce the expression levels of the adhesion | RAGE | Receptor for advanced glycation endproducts (RAGE) | Human | Neutrophils and HUVECs | NA | Q15109.fasta | Q15109 | 404 | NA | NA | 28961019 | 2017 | Pubchem_assay |
| PRRID_2610 | S100 proteins Click for more detail | NA | MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE | 92 | Damage-associated molecular patterns (DAMPs) | Natural | Induce the expression levels of the adhesion | RAGE | Receptor for advanced glycation endproducts (RAGE) | Human | Neutrophils and HUVECs | NA | Q15109.fasta | Q15109 | 404 | NA | NA | 28961019 | 2017 | Pubchem_assay |
| PRRID_2611 | S100 proteins Click for more detail | NA | MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE | 92 | Damage-associated molecular patterns (DAMPs) | Natural | Induce the expression levels of the adhesion | RAGE | Receptor for advanced glycation endproducts (RAGE) | Human | Neutrophils and HUVECs | NA | Q15109.fasta | Q15109 | 404 | NA | NA | 28961019 | 2017 | Pubchem_assay |
| PRRID_2611 | S100 proteins Click for more detail | NA | MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE | 92 | Damage-associated molecular patterns (DAMPs) | Natural | Induce the expression levels of the adhesion | RAGE | Receptor for advanced glycation endproducts (RAGE) | Human | Neutrophils and HUVECs | NA | Q15109.fasta | Q15109 | 404 | NA | NA | 28961019 | 2017 | Pubchem_assay |
| PRRID_2649 | Tenascin C Click for more detail | ECM glycoprotein(others) | MGAMTQLLAGVFLAFLALATEGGVLKKVIRHKRQSGVNATLPEENQPVVFNHVYNIKLPVGSQCSVDLESASGEKDLAPPSEPSESFQEHTVDGENQIVFTHRINIPRRACGCAAAPDVKELLSRLEELENLVSSLREQCTAGAGCCLQPATGRLDTRPFCSGRGNFSTEGCGCVCEPGWKGPNCSEPECPGNCHLRGRCIDGQCICDDGFTGEDCSQLACPSDCNDQGKCVNGVCICFEGYAGADCSREICPVPCSEEHGTCVDGLCVCHDGFAGDDCNKPLCLNNCYNRGRCVENECVCDEGFTGEDCSELICPNDCFDRGRCINGTCYCEEGFTGEDCGKPTCPHACHTQGRCEEGQCVCDEGFAGVDCSEKRCPADCHNRGRCVDGRCECDDGFTGADCGELKCPNGCSGHGRCVNGQCVCDEGYTGEDCSQLRCPNDCHSRGRCVEGKCVCEQGFKGYDCSDMSCPNDCHQHGRCVNGMCVCDDGYTGEDCRDRQCPRDCSNRGLCVDGQCVCEDGFTGPDCAELSCPNDCHGQGRCVNGQCVCHEGFMGKDCKEQRCPSDCHGQGRCVDGQCICHEGFTGLDCGQHSCPSDCNNLGQCVSGRCICNEGYSGEDCSEVSPPKDLVVTEVTEETVNLAWDNEMRVTEYLVVYTPTHEGGLEMQFRVPGDQTSTIIQELEPGVEYFIRVFAILENKKSIPVSARVATYLPAPEGLKFKSIKETSVEVEWDPLDIAFETWEIIFRNMNKEDEGEITKSLRRPETSYRQTGLAPGQEYEISLHIVKNNTRGPGLKRVTTTRLDAPSQIEVKDVTDTTALITWFKPLAEIDGIELTYGIKDVPGDRTTIDLTEDENQYSIGNLKPDTEYEVSLISRRGDMSSNPAKETFTTGLDAPRNLRRVSQTDNSITLEWRNGKAAIDSYRIKYAPISGGDHAEVDVPKSQQATTKTTLTGLRPGTEYGIGVSAVKEDKESNPATINAATELDTPKDLQVSETAETS | 2201 | Damage-associated molecular patterns (DAMPs) | Natural | involved in the resolution and fine-tuning of inflammation by orchestrating the production of anti-inflammatory mediators that are required for the resolution of tissue inflammation and the transition to acquired immunity | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | NA | NA | Leucine-rich Repeat (LRR) Domain | NA | NA | NA | NA | NA | 29290139 | 2017 | NA |
| PRRID_2649 | Tenascin C Click for more detail | ECM glycoprotein(others) | MGAMTQLLAGVFLAFLALATEGGVLKKVIRHKRQSGVNATLPEENQPVVFNHVYNIKLPVGSQCSVDLESASGEKDLAPPSEPSESFQEHTVDGENQIVFTHRINIPRRACGCAAAPDVKELLSRLEELENLVSSLREQCTAGAGCCLQPATGRLDTRPFCSGRGNFSTEGCGCVCEPGWKGPNCSEPECPGNCHLRGRCIDGQCICDDGFTGEDCSQLACPSDCNDQGKCVNGVCICFEGYAGADCSREICPVPCSEEHGTCVDGLCVCHDGFAGDDCNKPLCLNNCYNRGRCVENECVCDEGFTGEDCSELICPNDCFDRGRCINGTCYCEEGFTGEDCGKPTCPHACHTQGRCEEGQCVCDEGFAGVDCSEKRCPADCHNRGRCVDGRCECDDGFTGADCGELKCPNGCSGHGRCVNGQCVCDEGYTGEDCSQLRCPNDCHSRGRCVEGKCVCEQGFKGYDCSDMSCPNDCHQHGRCVNGMCVCDDGYTGEDCRDRQCPRDCSNRGLCVDGQCVCEDGFTGPDCAELSCPNDCHGQGRCVNGQCVCHEGFMGKDCKEQRCPSDCHGQGRCVDGQCICHEGFTGLDCGQHSCPSDCNNLGQCVSGRCICNEGYSGEDCSEVSPPKDLVVTEVTEETVNLAWDNEMRVTEYLVVYTPTHEGGLEMQFRVPGDQTSTIIQELEPGVEYFIRVFAILENKKSIPVSARVATYLPAPEGLKFKSIKETSVEVEWDPLDIAFETWEIIFRNMNKEDEGEITKSLRRPETSYRQTGLAPGQEYEISLHIVKNNTRGPGLKRVTTTRLDAPSQIEVKDVTDTTALITWFKPLAEIDGIELTYGIKDVPGDRTTIDLTEDENQYSIGNLKPDTEYEVSLISRRGDMSSNPAKETFTTGLDAPRNLRRVSQTDNSITLEWRNGKAAIDSYRIKYAPISGGDHAEVDVPKSQQATTKTTLTGLRPGTEYGIGVSAVKEDKESNPATINAATELDTPKDLQVSETAETS | 2201 | Damage-associated molecular patterns (DAMPs) | Natural | involved in the resolution and fine-tuning of inflammation by orchestrating the production of anti-inflammatory mediators that are required for the resolution of tissue inflammation and the transition to acquired immunity | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | NA | NA | Leucine-rich Repeat (LRR) Domain | NA | NA | NA | NA | NA | 29290139 | 2017 | NA |
| PRRID_2670 | Uric acid Click for more detail | Cytosol(others) | C12=C(NC(=O)N1)NC(=O)NC2=O | NA | Damage-associated molecular patterns (DAMPs) | Natural | involved in the resolution and fine-tuning of inflammation by orchestrating the production of anti-inflammatory mediators that are required for the resolution of tissue inflammation and the transition to acquired immunity | Nod-like receptor P3 (NLRP3) | NOD-like receptor (NLR) | NA | NA | NA | NA | NA | NA | NA | NA | 29290139 | 2017 | NA |
| PRRID_2670 | Uric acid Click for more detail | Cytosol(others) | C12=C(NC(=O)N1)NC(=O)NC2=O | NA | Damage-associated molecular patterns (DAMPs) | Natural | involved in the resolution and fine-tuning of inflammation by orchestrating the production of anti-inflammatory mediators that are required for the resolution of tissue inflammation and the transition to acquired immunity | Nod-like receptor P3 (NLRP3) | NOD-like receptor (NLR) | NA | NA | NA | NA | NA | NA | NA | NA | 29290139 | 2017 | NA |
| PRRID_2671 | Uric acid Click for more detail | NA | C12=C(NC(=O)N1)NC(=O)NC2=O | NA | Damage-associated molecular patterns (DAMPs) | Natural | Induce the synthesis of IL-1β, TNF-α and TGF-β by murine macrophages. | Nod-like receptor P3 (NLRP3) | NOD-like receptor (NLR) | Mice | Microglia | NA | Q8R4B8.fasta | Q8R4B8 | 1033 | NLRP3 inflammasome activation in AD models | NA | 28805121 | 2017 | Pubchem_assay |
| PRRID_2671 | Uric acid Click for more detail | NA | C12=C(NC(=O)N1)NC(=O)NC2=O | NA | Damage-associated molecular patterns (DAMPs) | Natural | Induce the synthesis of IL-1β, TNF-α and TGF-β by murine macrophages. | Nod-like receptor P3 (NLRP3) | NOD-like receptor (NLR) | Mice | Microglia | NA | Q8R4B8.fasta | Q8R4B8 | 1033 | NLRP3 inflammasome activation in AD models | NA | 28805121 | 2017 | Pubchem_assay |
| PRRID_2672 | Uric acid Click for more detail | NA | C12=C(NC(=O)N1)NC(=O)NC2=O | NA | Damage-associated molecular patterns (DAMPs) | Natural | Induce the synthesis of IL-1β, TNF-α and TGF-β by murine macrophages. | Nod-like receptor P3 (NLRP3) | NOD-like receptor (NLR) | Mice | cortical neurons (cell culture, stroke model) | NA | Q8R4B8.fasta | Q8R4B8 | 1033 | protein ↑ in ischemia/reperfusion, role in neuronal cell death and behavioral deficits | NA | 28801521 | 2017 | Pubchem_assay |
| PRRID_2672 | Uric acid Click for more detail | NA | C12=C(NC(=O)N1)NC(=O)NC2=O | NA | Damage-associated molecular patterns (DAMPs) | Natural | Induce the synthesis of IL-1β, TNF-α and TGF-β by murine macrophages. | Nod-like receptor P3 (NLRP3) | NOD-like receptor (NLR) | Mice | cortical neurons (cell culture, stroke model) | NA | Q8R4B8.fasta | Q8R4B8 | 1033 | protein ↑ in ischemia/reperfusion, role in neuronal cell death and behavioral deficits | NA | 28801521 | 2017 | Pubchem_assay |
| PRRID_2673 | Uric acid Click for more detail | NA | C12=C(NC(=O)N1)NC(=O)NC2=O | NA | Damage-associated molecular patterns (DAMPs) | Natural | Induce the synthesis of IL-1β, TNF-α and TGF-β by murine macrophages. | Nod-like receptor P3 (NLRP3) | NOD-like receptor (NLR) | Human | Brain | NA | Q96P20.fasta | Q96P20 | 1036 | protein ↑ in ischemia/reperfusion, role in neuronal cell death and behavioral deficits | NA | 28801521 | 2017 | Pubchem_assay |
| PRRID_2673 | Uric acid Click for more detail | NA | C12=C(NC(=O)N1)NC(=O)NC2=O | NA | Damage-associated molecular patterns (DAMPs) | Natural | Induce the synthesis of IL-1β, TNF-α and TGF-β by murine macrophages. | Nod-like receptor P3 (NLRP3) | NOD-like receptor (NLR) | Human | Brain | NA | Q96P20.fasta | Q96P20 | 1036 | protein ↑ in ischemia/reperfusion, role in neuronal cell death and behavioral deficits | NA | 28801521 | 2017 | Pubchem_assay |
| PRRID_2674 | Uric acid Click for more detail | NA | C12=C(NC(=O)N1)NC(=O)NC2=O | NA | Damage-associated molecular patterns (DAMPs) | Natural | Induce the synthesis of IL-1β, TNF-α and TGF-β by murine macrophages. | Nod-like receptor P3 (NLRP3) | NOD-like receptor (NLR) | Rat | primary astrocytes | NA | D4A523.fasta | D4A523 | 1035 | protein ↑, activation of NLRP3 inflammasome in PD models | NA | 28801521 | 2017 | Pubchem_assay |
| PRRID_2674 | Uric acid Click for more detail | NA | C12=C(NC(=O)N1)NC(=O)NC2=O | NA | Damage-associated molecular patterns (DAMPs) | Natural | Induce the synthesis of IL-1β, TNF-α and TGF-β by murine macrophages. | Nod-like receptor P3 (NLRP3) | NOD-like receptor (NLR) | Rat | primary astrocytes | NA | D4A523.fasta | D4A523 | 1035 | protein ↑, activation of NLRP3 inflammasome in PD models | NA | 28801521 | 2017 | Pubchem_assay |
| PRRID_2675 | Uric acid Click for more detail | NA | C12=C(NC(=O)N1)NC(=O)NC2=O | NA | Damage-associated molecular patterns (DAMPs) | Natural | Induce the synthesis of IL-1β, TNF-α and TGF-β by murine macrophages. | Nod-like receptor P3 (NLRP3) | NOD-like receptor (NLR) | Mice | substantia nigra | NA | Q8R4B8.fasta | Q8R4B8 | 1033 | protein ↑, activation of NLRP3 inflammasome in PD models | NA | 28801521 | 2017 | Pubchem_assay |
| PRRID_2675 | Uric acid Click for more detail | NA | C12=C(NC(=O)N1)NC(=O)NC2=O | NA | Damage-associated molecular patterns (DAMPs) | Natural | Induce the synthesis of IL-1β, TNF-α and TGF-β by murine macrophages. | Nod-like receptor P3 (NLRP3) | NOD-like receptor (NLR) | Mice | substantia nigra | NA | Q8R4B8.fasta | Q8R4B8 | 1033 | protein ↑, activation of NLRP3 inflammasome in PD models | NA | 28801521 | 2017 | Pubchem_assay |
| PRRID_2676 | Uric acid Click for more detail | NA | C12=C(NC(=O)N1)NC(=O)NC2=O | NA | Damage-associated molecular patterns (DAMPs) | Natural | Induce the synthesis of IL-1β, TNF-α and TGF-β by murine macrophages. | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Mice (Murine) | Macrophages | Leucine-rich Repeat (LRR) Domain | Q9NR97.fasta | Q9QUK7 | 511 | NA | NA | 28961019 | 2017 | Pubchem_assay |
| PRRID_2676 | Uric acid Click for more detail | NA | C12=C(NC(=O)N1)NC(=O)NC2=O | NA | Damage-associated molecular patterns (DAMPs) | Natural | Induce the synthesis of IL-1β, TNF-α and TGF-β by murine macrophages. | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Mice (Murine) | Macrophages | Leucine-rich Repeat (LRR) Domain | Q9NR97.fasta | Q9QUK7 | 511 | NA | NA | 28961019 | 2017 | Pubchem_assay |
| PRRID_2677 | Uric acid Click for more detail | NA | C12=C(NC(=O)N1)NC(=O)NC2=O | NA | Damage-associated molecular patterns (DAMPs) | Natural | Induce the synthesis of IL-1β, TNF-α and TGF-β by murine macrophages. | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Mice (Murine) | Macrophages | Leucine-rich Repeat (LRR) Domain | Q9QUN6.fasta | Q9QUK6 | 835 | NA | NA | 28961019 | 2017 | Pubchem_assay |
| PRRID_2677 | Uric acid Click for more detail | NA | C12=C(NC(=O)N1)NC(=O)NC2=O | NA | Damage-associated molecular patterns (DAMPs) | Natural | Induce the synthesis of IL-1β, TNF-α and TGF-β by murine macrophages. | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Mice (Murine) | Macrophages | Leucine-rich Repeat (LRR) Domain | Q9QUN6.fasta | Q9QUK6 | 835 | NA | NA | 28961019 | 2017 | Pubchem_assay |
| PRRID_2678 | Uric acid Click for more detail | NA | C12=C(NC(=O)N1)NC(=O)NC2=O | NA | Damage-associated molecular patterns (DAMPs) | Natural | Induce the synthesis of IL-1, IL-6, IL-8, TNF-α, TXA2 and PGE2 by human monocytes. | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Human | Monocyte | Leucine-rich Repeat (LRR) Domain | O60603.fasta | O60603 | 784 | NA | NA | 28961019 | 2017 | Pubchem_assay |
| PRRID_2678 | Uric acid Click for more detail | NA | C12=C(NC(=O)N1)NC(=O)NC2=O | NA | Damage-associated molecular patterns (DAMPs) | Natural | Induce the synthesis of IL-1, IL-6, IL-8, TNF-α, TXA2 and PGE2 by human monocytes. | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Human | Monocyte | Leucine-rich Repeat (LRR) Domain | O60603.fasta | O60603 | 784 | NA | NA | 28961019 | 2017 | Pubchem_assay |
| PRRID_2679 | Uric acid Click for more detail | NA | C12=C(NC(=O)N1)NC(=O)NC2=O | NA | Damage-associated molecular patterns (DAMPs) | Natural | Induce the synthesis of IL-1, IL-6, IL-8, TNF-α, TXA2 and PGE2 by human monocytes. | NA | Toll-like receptor (TLR) | Human | Monocyte | Leucine-rich Repeat (LRR) Domain | O00206.fasta | O00206 | 839 | NA | NA | 28961019 | 2017 | Pubchem_assay |
| PRRID_2679 | Uric acid Click for more detail | NA | C12=C(NC(=O)N1)NC(=O)NC2=O | NA | Damage-associated molecular patterns (DAMPs) | Natural | Induce the synthesis of IL-1, IL-6, IL-8, TNF-α, TXA2 and PGE2 by human monocytes. | NA | Toll-like receptor (TLR) | Human | Monocyte | Leucine-rich Repeat (LRR) Domain | O00206.fasta | O00206 | 839 | NA | NA | 28961019 | 2017 | Pubchem_assay |